SecReT4
Protein ID: 160899598
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4164
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4557694..4558272 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDA9C2Z1
KEGG IDdac:Daci_4164
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 192 a.a.     [Download]
>gi|160899598|ref|YP_001565180.1| hypothetical protein Daci_4164 [Delftia acidovorans SPH-1]
MPAIPVSRRLVGAGLLAAALASGCATTTAPLVPDAIEGVSSAPEPEAPEFIPVVRYGRYTLVELAPTAAQ
RDLLLQTIDVSMPEDARATVGDGLRHVLKRSGYQLCETPSAVTELYALPLPAAHRHLGPMTLRDALLTLA
GPAWELHADERARQICFEQPGGSATAEHAHEPPVAEAVQTFPLMPSVSGGQP
 
Nucleotide Sequence: 579 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4557694-4558272 Delftia acidovorans SPH-1 chromosome, complete genome
ATGCCCGCAATCCCTGTATCCCGGCGTCTGGTCGGCGCTGGTCTCCTGGCCGCAGCGCTGGCCAGCGGCT
GCGCGACCACCACCGCGCCGCTGGTGCCAGACGCCATAGAAGGCGTCTCCTCCGCTCCCGAACCCGAGGC
ACCCGAGTTCATTCCCGTCGTGCGCTATGGCCGCTACACGCTGGTCGAGCTGGCACCCACGGCGGCGCAG
CGTGACTTGCTGTTGCAGACCATCGACGTGTCCATGCCCGAGGATGCCCGCGCCACGGTGGGCGATGGGC
TGCGGCATGTGCTCAAACGCAGTGGCTACCAGCTTTGCGAGACGCCCAGCGCCGTGACCGAGTTGTATGC
GCTGCCGCTGCCGGCGGCGCACCGGCATCTTGGCCCCATGACCTTGCGCGATGCGCTGCTCACCCTGGCC
GGCCCGGCCTGGGAACTGCATGCGGATGAACGGGCACGGCAGATTTGCTTTGAGCAGCCTGGAGGCAGTG
CGACCGCCGAGCACGCACACGAGCCGCCTGTTGCCGAGGCGGTGCAGACGTTTCCGCTGATGCCTTCGGT
TTCGGGAGGCCAGCCATGA
 Primer design