SecReT4
Protein ID: 160899600
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4166
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4558925..4559662 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDA9C2Z3
KEGG IDdac:Daci_4166
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 245 a.a.     [Download]
>gi|160899600|ref|YP_001565182.1| hypothetical protein Daci_4166 [Delftia acidovorans SPH-1]
MKPSIILSALLLASAQLPAWAQQPATAPAGSAHSQERPLVTRSLDDRVAGDWGLQPQEWARYRELMDGPL
GIYSPNLDPLSALGIEARTDEERRRYAELQVQVEARRIEKLLAYQRAYDQAWQRLSPGMQRVNLPDEKPG
AGTSANPLRGSGRTAVFVKDGCAACGQLVQRLQSSGTEFDLYMVGSRQDDTRIRDWAKRANVDPARVRSG
GITLNHDGGRWLSLSLPGDLPAVVREVNGQWQRQP
 
Nucleotide Sequence: 738 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4558925-4559662 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAAACCGTCGATCATCCTTTCCGCGCTCCTGCTCGCGTCTGCCCAGTTGCCCGCCTGGGCGCAGCAGC
CGGCCACGGCTCCCGCCGGCAGTGCGCACAGCCAGGAGCGCCCGCTGGTTACTCGCTCCCTGGACGACCG
AGTGGCAGGCGACTGGGGCCTGCAACCGCAGGAGTGGGCTCGCTATCGCGAGCTGATGGACGGGCCGTTG
GGCATCTACTCGCCCAACCTGGACCCACTGTCCGCCCTGGGCATCGAGGCGCGCACCGACGAGGAACGGC
GCCGCTACGCAGAGCTGCAGGTGCAGGTCGAGGCGCGCCGTATCGAGAAGCTGCTCGCCTACCAGCGTGC
CTACGACCAGGCCTGGCAGCGCCTGAGTCCCGGCATGCAGCGGGTGAACCTGCCTGACGAAAAACCCGGC
GCCGGCACAAGCGCCAATCCCTTGCGCGGTTCAGGCCGCACGGCCGTGTTCGTCAAGGACGGCTGCGCGG
CCTGCGGGCAACTCGTGCAGCGCCTGCAATCCTCCGGCACCGAGTTCGACCTGTACATGGTCGGCAGCCG
CCAAGACGACACGCGCATCCGCGACTGGGCCAAGCGTGCGAACGTCGATCCGGCGCGCGTGCGCAGCGGT
GGCATCACGCTCAACCATGATGGCGGGCGGTGGCTGTCGCTGAGCTTGCCCGGAGACCTTCCTGCGGTCG
TGCGCGAGGTGAACGGTCAATGGCAGCGCCAGCCATAG
 Primer design