SecReT4
Protein ID: 160899601
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4167
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4559644..4560249 [+]
Productlytic transglycosylase catalytic subunit
Component typeTfc4
UniProt IDA9C2Z4
KEGG IDdac:Daci_4167
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 201 a.a.     [Download]
>gi|160899601|ref|YP_001565183.1| lytic transglycosylase catalytic subunit [Delftia acidovorans SPH-1]
MAAPAIAATSVSQCLRALVIAAGLCACAAHAQELPPPAYQLAAQRAGIPSTVLYAVALQESGIRRNGRIV
PWPWSLNVAGQSRRFTTRADACAGLQQAMRATPHTRIDAGLGQINLGYHQQRYASPCDLLDPYSNLAIAA
EILKEQHTSGEDWLPAIGRYHRPAGGEPAARYRRSVSRHLARVQGTHPTAAAIAVHQESTP
 
Nucleotide Sequence: 606 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4559644-4560249 Delftia acidovorans SPH-1 chromosome, complete genome
ATGGCAGCGCCAGCCATAGCGGCCACCTCCGTTTCGCAGTGCTTGCGCGCACTGGTGATCGCGGCGGGCC
TGTGCGCCTGCGCCGCCCATGCCCAGGAGCTTCCGCCACCGGCTTACCAGCTTGCCGCACAGCGCGCGGG
CATCCCCTCGACGGTGCTCTACGCCGTGGCTTTGCAGGAAAGCGGCATCCGCCGCAACGGGCGCATCGTC
CCGTGGCCGTGGTCCCTCAACGTCGCCGGTCAGTCGCGCCGCTTCACCACCCGTGCCGACGCCTGCGCTG
GTTTGCAGCAGGCAATGCGCGCCACGCCGCACACACGCATCGACGCGGGCCTGGGCCAGATCAACCTCGG
CTACCACCAGCAGCGCTACGCCAGCCCGTGCGACCTGCTCGACCCATACAGCAACCTCGCCATCGCCGCT
GAAATCCTGAAAGAGCAGCACACCTCGGGCGAGGACTGGTTGCCGGCGATCGGTCGCTACCACCGTCCTG
CGGGCGGAGAACCTGCGGCTCGTTACCGGCGCAGCGTGTCGCGCCACCTTGCCCGTGTGCAGGGCACACA
CCCAACCGCCGCGGCCATCGCCGTGCACCAGGAGAGCACCCCATGA
 Primer design