SecReT4
Protein ID: 160899602
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4168
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4560246..4560794 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDA9C2Z5
KEGG IDdac:Daci_4168
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 4.8e-50, Aligned region: 34..181
Protein Sequence: 182 a.a.     [Download]
>gi|160899602|ref|YP_001565184.1| hypothetical protein Daci_4168 [Delftia acidovorans SPH-1]
MKTCHLTHLTLKGLLVLLAALPLASRAGEPLIVVEDRGGTSALPYYEALNLQPRANAPAGPPIPMLPVPA
TPMDEAAMLPVRSAKLTPGTVARRVIEAPGLRPFVVVGDDEASHAWLLRQAGSLRERGAVGLVVNVETMQ
GLARLRALVPGVPLAPVAGDDLAERLGLRHYPVLITATGIEQ
 
Nucleotide Sequence: 549 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4560246-4560794 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAAAACATGCCATTTGACCCATCTCACACTGAAGGGCCTGCTCGTGCTGCTGGCGGCTCTGCCACTGG
CCTCGCGCGCCGGAGAGCCCCTGATCGTCGTCGAAGACCGTGGCGGCACGTCGGCGCTGCCGTACTACGA
GGCTCTGAACCTTCAGCCGCGCGCCAATGCTCCGGCCGGGCCGCCCATCCCGATGCTCCCGGTGCCCGCC
ACGCCCATGGATGAGGCCGCGATGTTGCCGGTGCGCAGTGCCAAGCTCACGCCTGGCACCGTCGCGCGGC
GCGTGATCGAGGCACCGGGCCTGCGGCCTTTCGTAGTCGTCGGCGACGACGAAGCTTCCCACGCCTGGCT
GCTTCGCCAGGCGGGCTCGCTGCGCGAGCGCGGCGCGGTGGGCCTGGTGGTTAACGTCGAGACCATGCAG
GGCCTGGCACGGCTGCGCGCCCTGGTGCCCGGCGTGCCCCTTGCGCCTGTGGCCGGTGACGACCTGGCCG
AGCGCCTGGGTCTGCGGCATTACCCGGTGCTGATCACAGCCACCGGCATCGAGCAATGA
 Primer design