SecReT4
Protein ID: 160899604
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4170
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4562979..4563740 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDA9C2Z7
KEGG IDdac:Daci_4170
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.9e-69, Aligned region: 46..250
Protein Sequence: 253 a.a.     [Download]
>gi|160899604|ref|YP_001565186.1| hypothetical protein Daci_4170 [Delftia acidovorans SPH-1]
MSDAASTAQREQNRRQGLIVGTITLPLRLLGVLVGSLLFSILMECIGMHLFWKDQGWQHSQQMLQYELGH
LSKHFTRSVVVQEPGRTAHELVDTGYEWVFVRSGLLERMSQTAERARAPSQGKNQDGGRNFRYFISQVYV
WTESYLIAAAFTTLTFLVRLLVLALTLPLIFTAAFVGLIDGLVRRDVRRFGAGRESGFIYHRAKASLMPL
AVLPWVTYLALPISVHPLLILLPSAGLLGLAVSLTAGSFKKYL
 
Nucleotide Sequence: 762 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4562979-4563740 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAGCGATGCCGCCTCGACTGCGCAGCGCGAGCAGAACCGCCGCCAGGGCTTGATCGTCGGCACCATCA
CCTTGCCGCTCCGGCTGCTCGGGGTGCTGGTCGGCTCGCTGCTGTTCTCGATCCTGATGGAGTGCATCGG
CATGCACCTGTTCTGGAAAGACCAGGGCTGGCAGCACTCCCAGCAAATGTTGCAGTACGAGCTGGGGCAC
CTGTCCAAGCATTTCACGCGCAGCGTGGTCGTGCAGGAGCCGGGGCGAACGGCGCACGAGCTGGTGGACA
CGGGTTATGAATGGGTGTTCGTGCGATCAGGGCTCCTGGAGCGCATGAGCCAGACCGCCGAGCGCGCCCG
CGCGCCCAGCCAGGGGAAAAACCAGGACGGAGGGCGCAACTTCCGCTACTTCATCAGCCAGGTCTATGTC
TGGACGGAGAGCTACCTGATCGCCGCAGCCTTCACGACGCTTACTTTCCTCGTGCGCCTGCTGGTCCTGG
CGCTCACGCTGCCGCTGATCTTCACGGCCGCTTTCGTCGGCCTGATCGACGGTTTGGTACGGCGGGATGT
GCGCCGGTTCGGCGCAGGCCGGGAATCCGGCTTTATCTATCACCGAGCGAAAGCGAGCCTGATGCCGCTG
GCCGTGCTGCCCTGGGTCACGTACCTGGCGCTGCCGATCTCGGTGCATCCGCTGCTGATCCTGCTGCCCA
GCGCCGGCTTGCTGGGGCTGGCCGTGAGCCTGACTGCAGGGAGCTTCAAGAAGTACCTCTAG
 Primer design