SecReT4
Protein ID: 160899605
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4171
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4563839..4564222 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDA9C2Z8
KEGG IDdac:Daci_4171
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.1e-29, Aligned region: 30..109
Protein Sequence: 127 a.a.     [Download]
>gi|160899605|ref|YP_001565187.1| hypothetical protein Daci_4171 [Delftia acidovorans SPH-1]
MLAPIWLRAAHRGVPTFLVTALLMGQFPVALAESPAQRQELVAALRQLDALERTIADGAAHAPIQPGERY
HFDYPRLLADLARVRAGIQAYLTPSRAQPRDLSELAGEYRTERTAPPSLPTTAQGRP
 
Nucleotide Sequence: 384 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4563839-4564222 Delftia acidovorans SPH-1 chromosome, complete genome
ATGTTGGCTCCGATCTGGCTGCGCGCCGCGCATCGCGGCGTGCCAACTTTTCTCGTGACGGCCCTGCTGA
TGGGTCAGTTCCCGGTTGCCTTGGCCGAATCCCCGGCACAGCGCCAGGAGCTGGTTGCCGCGCTACGCCA
GCTCGACGCGCTGGAGCGCACCATCGCGGATGGCGCTGCACACGCACCCATCCAGCCGGGCGAGCGCTAC
CACTTCGATTACCCACGACTGCTGGCTGATCTGGCGCGTGTGCGCGCCGGCATCCAGGCCTATCTCACAC
CGTCGCGCGCCCAGCCACGCGACCTCTCCGAACTGGCTGGTGAGTACCGCACCGAGCGGACCGCCCCGCC
ATCGCTGCCGACGACTGCGCAGGGCAGACCATGA
 Primer design