SecReT4
Protein ID: 160899608
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4174
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4564842..4565252 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDA9C301
KEGG IDdac:Daci_4174
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.5e-48, Aligned region: 10..130
Protein Sequence: 136 a.a.     [Download]
>gi|160899608|ref|YP_001565190.1| hypothetical protein Daci_4174 [Delftia acidovorans SPH-1]
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLVVGAPLSWVLRTIAIAPTFVVLG
VALGVFIGGGILRRLKRGRPDTWLYRQLQWRIATRHPLMAAWVGGHVLISRSGFWTIRRGMHGGAR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4564842-4565252 Delftia acidovorans SPH-1 chromosome, complete genome
ATGTCCGAGCAACAGCATGTCCGTGCCGATGGGACAGTCACGTTCCTTCCACACCGGCTCAACAGGCACC
CGGTGGTCGTGCGCGGCCTCACTGCCGATGAGTTGTGGATTTGCTGCGGCCTGTCCGGCGCTGCCGGCCT
GGTGGTTGGCGCGCCGCTGTCCTGGGTGTTACGCACCATTGCCATCGCGCCGACCTTCGTTGTCCTGGGC
GTGGCGCTGGGCGTTTTCATCGGCGGCGGCATCCTGCGCCGTCTCAAGCGTGGGCGTCCCGACACCTGGC
TGTACCGGCAGTTGCAGTGGCGCATTGCCACGCGCCATCCGCTGATGGCCGCTTGGGTGGGCGGCCATGT
GCTGATCTCGCGCTCCGGCTTCTGGACCATCCGCAGGGGCATGCACGGGGGCGCGCGATGA
 Primer design