SecReT4
Protein ID: 160899609
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4175
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4565249..4565941 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDA9C302
KEGG IDdac:Daci_4175
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 9.7e-89, Aligned region: 6..206
Protein Sequence: 230 a.a.     [Download]
>gi|160899609|ref|YP_001565191.1| hypothetical protein Daci_4175 [Delftia acidovorans SPH-1]
MSRFKNEITHLQAHIKTLRLGAGALVIVALVMGGGWWSAPRDLTIHVPPDLRSGSTRKWWEVPPESVYAF
TFYVFQTLNRWPTNGEEDYPRNLHTLSPYLTPSCQAFLKADYDYRRSTGELRQRVRGIYEIPGRSYGDNP
TARVRVISDRDWVVTLDISADEYYGAEQVKRALVRYPVKVARVDVDPARNPFGLVIDCYEGTPQRISAPE
PTRPVPGGLTPQAPQGGNSP
 
Nucleotide Sequence: 693 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4565249-4565941 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAGCCGTTTCAAGAACGAGATCACCCACCTGCAGGCGCACATCAAGACGCTGCGCCTCGGCGCGGGTG
CGCTGGTCATCGTCGCCCTGGTCATGGGCGGCGGCTGGTGGAGCGCACCGCGCGATCTGACCATCCACGT
CCCGCCTGACCTACGCTCCGGCAGTACCCGCAAGTGGTGGGAAGTGCCGCCCGAGTCGGTCTATGCGTTC
ACGTTCTACGTGTTCCAGACCCTCAACCGCTGGCCGACGAATGGCGAAGAAGATTACCCGCGCAACCTCC
ATACGCTCTCGCCGTACCTCACCCCGTCCTGCCAGGCATTCCTCAAGGCGGACTACGACTACCGCCGCAG
CACCGGCGAACTGCGCCAGCGGGTGCGCGGCATCTACGAAATCCCCGGTCGCAGCTATGGCGACAACCCC
ACGGCGCGCGTGCGTGTGATCTCCGACCGCGACTGGGTGGTGACGTTGGACATCAGCGCCGACGAGTACT
ACGGCGCCGAGCAGGTCAAACGCGCCCTGGTGCGCTACCCCGTAAAGGTCGCGCGGGTGGACGTCGATCC
CGCACGCAACCCGTTCGGCCTGGTGATCGACTGCTACGAGGGCACGCCCCAGCGCATCAGCGCACCGGAG
CCGACGCGCCCGGTGCCTGGTGGCCTGACGCCGCAAGCGCCTCAAGGAGGTAATTCCCCATGA
 Primer design