SecReT4
Protein ID: 160899610
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4176
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4565938..4566876 [+]
Productputative signal peptide
Component typeTfc13
UniProt IDA9C303
KEGG IDdac:Daci_4176
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 6.9e-125, Aligned region: 14..294
Protein Sequence: 312 a.a.     [Download]
>gi|160899610|ref|YP_001565192.1| putative signal peptide [Delftia acidovorans SPH-1]
MKPMKHPVLALLGLLAVAAAVVVSPAVQAVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAGVGERL
RVQSAGGAVYLRASEPIEPTRLQLQDADTGALILLDIAAEPPKDGEAELEPVRIVEGNNSTARYGDQPDG
ADAPHARAQEQAGTRTARRETPIPVVLTRFAAQNLYAPLRTVEALPGVMRVNLRRDLDLGTLMPTLPARA
VALASWRLEDQWVTAVRLTNSSNDWISLDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGHGLAQ
SLLPAIHRFDPAVHLPQPKAAASDDREARHAQ
 
Nucleotide Sequence: 939 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4565938-4566876 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAAGCCCATGAAGCATCCTGTACTCGCGCTGCTGGGGCTGCTGGCCGTGGCCGCCGCAGTGGTCGTGT
CCCCCGCTGTCCAGGCGGTGGAGATCCTGCGTTGGGAGCGCATGCCGCTGGCGGTGCCGTTGAAGGTCGG
CCAGGAGCGCATCGTGTTCATCGACCGAAACGTCCGCGTGGGCGTTCCCGCAGGCGTCGGTGAGCGCTTG
CGCGTGCAGAGCGCGGGCGGCGCGGTGTACCTGCGCGCCAGCGAGCCGATCGAGCCCACTCGGCTGCAAT
TGCAGGACGCCGACACCGGCGCGCTGATCCTGCTCGACATTGCGGCGGAGCCGCCCAAGGACGGCGAAGC
CGAGCTGGAACCGGTGCGAATCGTCGAGGGCAACAACTCAACAGCGCGCTATGGCGATCAGCCTGACGGT
GCCGATGCGCCCCATGCACGCGCTCAGGAGCAGGCGGGCACCCGGACGGCGCGGCGCGAAACGCCAATCC
CCGTCGTGCTGACACGTTTTGCTGCGCAGAACCTCTACGCACCGCTGCGCACCGTGGAAGCCTTGCCAGG
CGTCATGCGGGTCAACCTGCGCCGCGACCTCGACCTCGGCACGCTGATGCCGACCTTGCCGGCACGCGCG
GTCGCGCTCGCCTCGTGGCGCCTGGAAGACCAGTGGGTCACTGCCGTGCGCCTGACCAACAGTAGCAACG
ACTGGATCAGCCTCGACCCGCGCGTGCTGCAAGGGGATTTCCTCACCGCCACCTTCCAGCACGAGGCGCT
TGGCCCGCGCGGAACCCCCGAGGACACCACCGTCCTGTACCTGGTGACGCGCGGGCACGGCCTCGCGCAA
TCGCTGCTGCCGGCGATCCATCGCTTCGACCCCGCTGTGCATCTCCCGCAGCCCAAAGCAGCAGCCAGCG
ACGACAGGGAGGCCCGCCATGCGCAGTAA
 Primer design