SecReT4
Protein ID: 160899613
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4179
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4568705..4571614 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDA9C306
KEGG IDdac:Daci_4179
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 3.3e-66, Aligned region: 66..345
AAA_10 [PF12846], Evalue: 1.9e-46, Aligned region: 539..881
Protein Sequence: 969 a.a.     [Download]
>gi|160899613|ref|YP_001565195.1| hypothetical protein Daci_4179 [Delftia acidovorans SPH-1]
MRWKIPRPKPTAPKLAASDADDDEQPDGWQRHVEALRQAGIPEPGTAVQGRRPATLADEQALYEVAPSFV
ELLPWVEFLAQSKAMLLEDGQSVAAFYELVPLGTEGREPGWLAQARDALENALQDSFDELDENPWVLQLY
AQDEPSFDQYMQTLRDYVQPRARETAFTEFYLRFFGHHLRAVAKPGGLFEDTVVTRLRWRGQTRRVRMVV
YRRVTGQGQNSRRGQTPEQMLNIVCDRLCGGLANAGIQARRMVAADVHDWLLRWFNPRPTLLGPGAEDRE
RFYALARYPDSTEAGEDGEIELASGRDFSQRLFFGQPRSDVAQGTWHFDGLPHRVLITDRLRMPPGTGHL
TGETRKGDAINTLFDQMPEDTTLCLTMVATPQDVLEADLNHLAKKAVGETLASEQTLKDVHEARSLIGSA
HKLYRGTLAFYLRGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPGQDRRKWYT
QLMFAQHAANLSPVWGRAQGTGHPGITMFNRGGGPITFDPLNRLDRQMNAHLFLFGPTGSGKSATLNNLL
NQVTAIYRPRLFIVEAGNSFGLFSDFARRLGLTVNRVKLAPGSGVTLAPFADARRLIETPSDVQTLDADA
LDEDLPPDAVAMEADEQRDVLGELEITARLMITGGEDKEEARMTRADRSLIRQCILDAAEHCHSKDGEKR
TVLTRDVRNALRTRSQDPTLPEMRRVRLLEMADAMDMFCQGTDGEMFDRDGSPWPEADITLVDLATYARE
GYNAQLSIAYISLISTVNNIAERDQYLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQ
NIDDLPRAAEPMLNMIEWWICLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKSLEVLF
RAVPPSLYLALAQTEPEEKAERYQLMQQHGISELDAAFKVAEKIDQARGIESPALGLPQ
 
Nucleotide Sequence: 2910 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4568705-4571614 Delftia acidovorans SPH-1 chromosome, complete genome
ATGCGCTGGAAAATCCCCAGACCGAAGCCGACCGCGCCGAAGCTGGCCGCATCCGATGCTGACGACGACG
AGCAGCCGGACGGCTGGCAACGCCACGTCGAGGCACTGCGCCAGGCCGGCATCCCCGAACCCGGCACGGC
GGTGCAAGGCCGCAGGCCGGCGACCCTGGCAGACGAGCAGGCGCTGTACGAGGTCGCGCCGTCGTTCGTG
GAACTGCTGCCCTGGGTGGAGTTCCTGGCGCAGTCGAAAGCCATGTTGCTGGAGGACGGGCAATCGGTGG
CGGCGTTCTACGAGCTGGTGCCGCTGGGCACCGAAGGCCGGGAACCTGGCTGGCTCGCGCAGGCCCGCGA
TGCCTTGGAAAACGCGCTGCAGGACAGTTTCGATGAACTGGATGAGAACCCCTGGGTGCTGCAGCTCTAC
GCTCAGGACGAGCCCAGTTTCGACCAGTACATGCAGACCCTGCGCGACTATGTGCAGCCGCGCGCCCGTG
AGACGGCGTTCACCGAGTTCTACCTGCGCTTCTTCGGCCATCACCTGCGCGCGGTGGCCAAGCCGGGCGG
TCTGTTCGAGGACACGGTGGTCACACGGCTGCGCTGGCGCGGCCAGACCCGGCGTGTGCGCATGGTGGTC
TATCGCCGCGTGACCGGCCAAGGGCAAAACAGCCGCCGCGGGCAGACGCCCGAGCAGATGCTCAATATCG
TTTGCGACCGCCTGTGCGGCGGACTGGCGAACGCCGGCATTCAGGCCCGGCGCATGGTGGCTGCGGATGT
TCACGACTGGCTGCTGCGCTGGTTCAACCCGCGTCCCACGTTGCTTGGGCCTGGGGCCGAAGACAGGGAG
CGCTTCTATGCGCTGGCGCGCTACCCCGACAGTACGGAGGCCGGCGAAGACGGCGAGATCGAATTGGCGA
GCGGGCGGGATTTCAGCCAGCGGCTGTTCTTCGGCCAGCCGCGCTCCGACGTGGCGCAGGGCACCTGGCA
TTTCGACGGCCTGCCGCACCGCGTGCTGATCACCGACCGCCTGCGCATGCCGCCGGGCACAGGGCACCTG
ACCGGCGAGACACGCAAAGGCGATGCCATCAACACGCTGTTCGACCAGATGCCCGAGGACACCACCCTTT
GCCTGACGATGGTCGCCACGCCGCAGGATGTCCTTGAGGCGGACTTGAACCACCTGGCCAAGAAAGCGGT
CGGCGAAACCCTGGCGTCGGAGCAGACGCTCAAGGACGTGCATGAAGCCCGTTCCCTGATCGGCAGCGCG
CACAAGCTCTATCGCGGCACGCTGGCGTTCTACCTGCGCGGGCGCGATGAGGCGGAACTGGACCGACGCG
GCCTGGATCTGGCGAACGTCATGCTCAACGCTGGCCTGCAGCCGGTGCGCGAGGACGACGAGGTGGCACC
GCTCAACAGCTACCTGCGCTGGCTGCCGTGCTGCTACAACCCCGGCCAGGATCGGCGCAAGTGGTACACC
CAACTGATGTTCGCCCAGCACGCGGCGAACCTCTCGCCGGTGTGGGGCCGCGCCCAGGGTACGGGGCACC
CCGGCATCACGATGTTCAACCGCGGCGGCGGGCCGATCACCTTCGACCCGCTCAACCGCCTGGACCGGCA
GATGAACGCCCACCTGTTCCTGTTCGGCCCGACGGGTTCGGGCAAGTCGGCGACCCTCAACAACCTCTTG
AATCAGGTCACGGCGATCTACCGACCCCGCCTGTTCATTGTCGAGGCCGGCAACAGCTTTGGCTTGTTCA
GCGACTTTGCCCGGCGCCTGGGCCTGACCGTGAACCGGGTCAAGCTCGCGCCGGGCTCGGGCGTTACCCT
GGCGCCGTTCGCGGATGCGCGCCGGCTGATCGAGACGCCCAGCGACGTGCAGACGCTCGACGCCGATGCC
CTGGACGAAGACCTGCCGCCCGATGCTGTGGCCATGGAGGCAGATGAGCAGCGCGACGTACTGGGCGAAT
TGGAGATCACCGCGAGGCTGATGATCACCGGTGGCGAAGACAAGGAAGAAGCCCGGATGACGCGGGCCGA
CCGCTCGCTGATCCGTCAGTGCATCCTCGATGCCGCAGAACACTGCCACAGCAAGGATGGCGAGAAGCGC
ACCGTGCTCACGCGCGATGTGCGCAATGCGCTGCGCACGCGCAGCCAGGACCCGACGCTGCCGGAAATGC
GGCGTGTGCGACTGCTGGAGATGGCCGACGCCATGGACATGTTCTGCCAAGGCACGGACGGTGAAATGTT
CGACCGCGACGGTTCGCCGTGGCCCGAGGCCGACATCACCCTGGTCGATCTGGCGACCTATGCCCGCGAG
GGCTACAACGCGCAGCTCTCCATTGCCTACATAAGCCTGATCAGCACGGTGAACAACATTGCCGAGCGCG
ATCAGTACCTGGGCCGCCCGATCATCAACGTCACCGACGAAGGGCACATCATCACCAAGAACCCGCTGCT
CGCCCCCTACGTGGTGAAGATCACCAAGATGTGGCGCAAGCTGGGGGCCTGGTTCTGGCTCGCCACACAA
AACATCGACGATCTGCCGCGCGCCGCAGAGCCCATGCTCAACATGATCGAGTGGTGGATCTGCCTGTCGA
TGCCACCCGATGAGGTGGAGAAGATCGCCCGCTTCCGCGAACTCTCGCCTGCGCAGAAGGCGCTGATGCT
TTCGGCGCGCAAGGAAGCCGGGAAGTTCACCGAGGGCGTCATCCTCTCCAAGAGCCTGGAAGTGCTGTTT
CGGGCCGTGCCACCGAGCCTCTATCTCGCGCTTGCGCAGACCGAACCCGAGGAGAAAGCCGAGCGTTACC
AACTCATGCAACAGCACGGCATCAGTGAACTCGACGCGGCCTTCAAGGTGGCCGAGAAGATCGACCAGGC
GCGCGGCATCGAGTCGCCGGCCTTGGGCCTGCCGCAATAG
 Primer design