SecReT4
Protein ID: 160899616
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4182
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4573232..4573678 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDA9C309
KEGG IDdac:Daci_4182
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 2.2e-40, Aligned region: 35..145
Protein Sequence: 148 a.a.     [Download]
>gi|160899616|ref|YP_001565198.1| hypothetical protein Daci_4182 [Delftia acidovorans SPH-1]
MPASLFRFASGWRTLGLAVALPASLAVFSPATFAADVVVVTDSRHPVKTMGGERLIELDEGPRIEAELSA
QLPADPEQATAIVKRRLNNGGADLQRRIASAYQGVADAWSLGVTSIPAVVVDQRYVVYGEPDVARAVARI
EQHRRPQP
 
Nucleotide Sequence: 447 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4573232-4573678 Delftia acidovorans SPH-1 chromosome, complete genome
ATGCCAGCATCTTTATTCCGCTTCGCATCCGGCTGGCGAACCCTTGGCCTGGCCGTTGCACTGCCGGCAT
CCTTGGCCGTTTTCAGCCCAGCCACCTTCGCCGCCGATGTGGTGGTCGTCACCGACAGCCGCCACCCGGT
CAAGACCATGGGTGGCGAGCGGTTGATCGAGTTGGATGAAGGCCCGCGCATCGAAGCCGAGCTTTCCGCA
CAGCTGCCCGCCGATCCTGAGCAGGCCACGGCCATCGTCAAGCGCCGTCTGAACAACGGCGGTGCCGACC
TCCAGCGCCGCATTGCTTCCGCATACCAGGGCGTCGCCGACGCATGGAGCCTGGGCGTCACCAGCATCCC
GGCGGTCGTGGTGGATCAGCGTTACGTGGTCTATGGCGAGCCGGACGTGGCCCGTGCCGTCGCGCGCATC
GAGCAACACCGGAGGCCGCAGCCATGA
 Primer design