SecReT4
Protein ID: 160899617
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4183
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4573675..4574622 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDA9C310
KEGG IDdac:Daci_4183
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 6.4e-95, Aligned region: 33..303
Protein Sequence: 315 a.a.     [Download]
>gi|160899617|ref|YP_001565199.1| hypothetical protein Daci_4183 [Delftia acidovorans SPH-1]
MTRPFERMRRLRAGVVSVLLLSATGSYALNTATIVGSVASPDCLEYRVVGICYWLYCTWTGCTVRTSIKV
RHYIPDAVVSSYSNTGENPWVEVRAMSAPNPSAQAGGDGTTNEDHENNLAKFKNADVIGHPGVEVFNQFV
SSSGYFCEGAGTAFMPYLLSTLDTLAWRYNVPEMAYPEALIPGRREVGARTTMNLWGNVYPRGGFLHQAD
DHKAGAVVAQRAGDVVTRRGQIHVYQPLLANSRPGYWPAGALMEGDASTGKWQELTPVLSSSCTVFPRSG
FLTQAQQGDYAWALWRPYACCERRGQVFLGSVDFQ
 
Nucleotide Sequence: 948 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4573675-4574622 Delftia acidovorans SPH-1 chromosome, complete genome
ATGACCCGACCCTTCGAGCGGATGCGCCGCCTGCGTGCTGGCGTGGTCTCAGTGCTGCTGCTCAGCGCCA
CGGGCAGCTACGCCCTCAACACCGCAACCATCGTTGGCTCAGTGGCATCGCCGGACTGCCTCGAATACCG
CGTCGTCGGCATCTGCTACTGGCTCTACTGCACCTGGACGGGCTGCACGGTGCGCACATCCATCAAGGTC
CGCCACTACATCCCCGATGCGGTCGTCTCCAGCTACAGCAACACCGGCGAGAACCCTTGGGTCGAAGTCC
GGGCGATGAGCGCGCCCAACCCATCCGCGCAGGCCGGCGGGGACGGCACCACCAACGAAGACCACGAAAA
CAATCTCGCCAAGTTCAAGAACGCGGACGTCATCGGCCATCCCGGCGTCGAGGTGTTCAACCAGTTCGTC
TCATCGTCGGGCTACTTCTGCGAGGGCGCGGGCACGGCGTTCATGCCGTATCTGCTCAGCACCCTGGACA
CACTGGCCTGGCGCTACAACGTGCCGGAGATGGCCTACCCGGAGGCACTAATTCCGGGCAGGCGCGAGGT
CGGCGCGCGCACCACGATGAACCTGTGGGGCAACGTCTATCCGCGCGGCGGCTTCCTGCACCAGGCCGAC
GACCACAAGGCCGGCGCCGTGGTGGCCCAGCGCGCCGGCGATGTCGTCACGCGCCGTGGGCAGATTCACG
TCTATCAGCCGCTGCTCGCCAACTCGCGGCCCGGTTACTGGCCTGCCGGCGCGCTGATGGAAGGCGATGC
CTCGACGGGCAAGTGGCAGGAACTCACGCCCGTCCTGTCCTCGTCCTGCACGGTGTTCCCGCGCAGCGGC
TTCCTGACCCAGGCGCAGCAGGGCGATTACGCCTGGGCGCTGTGGCGGCCCTATGCGTGCTGCGAACGTC
GCGGCCAGGTATTCCTCGGCAGCGTCGATTTCCAATGA
 Primer design