SecReT4
Protein ID: 160899618
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4184
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4574633..4576039 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDA9C311
KEGG IDdac:Daci_4184
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 468 a.a.     [Download]
>gi|160899618|ref|YP_001565200.1| hypothetical protein Daci_4184 [Delftia acidovorans SPH-1]
MKRPELTNLSTKACRLLRPTVLAGLLAGALVLGGGLAWAQAGFQTGGSVIGDEVMYSIGGGSAVSMGRVA
GMRSIGVGVGWNSNLICGDMSIQTTLRNQLNGVTNGFQQIMSNVIQSATSAVASLPALIIQRADPGLYNL
LTNGVLQARLDFDRSKLTCRAMAEKMADTAGGQLGWSQMAEGMALRDAVSSTDAVSAIEQAETRRGNDGV
PWVGGSNAGGAGQSAIRVVGDVTRAGYNLVNGRSVTDTSSIAAASCASLSCQTWTSPQQATEWATRVLGE
QVQRTCDACTKTETVPGVGLTPLIQEEYEAKLEALQELVSGTRNTTFENLRAAGSTSLPITRGVIEALRD
EPDQDLLARRLASEVALASVLEKALLLQRTLLTGKKEPNVAANQLAVEAVNHESDTLDQEIRNLKTELEL
RRELANNSPMAIIQRHGTRAAGSRGIYEGDPIPDRLDRLQKGNPGGNP
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4574633-4576039 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAAGCGTCCTGAACTGACAAACCTCTCCACCAAGGCGTGCCGCCTGCTGCGTCCCACGGTATTGGCTG
GGCTGCTGGCTGGCGCACTCGTTCTTGGCGGCGGCCTGGCGTGGGCGCAGGCCGGATTTCAGACCGGCGG
CTCCGTGATCGGCGACGAAGTGATGTATTCGATTGGCGGCGGCAGCGCGGTGTCCATGGGCCGCGTGGCC
GGCATGCGCTCGATCGGCGTTGGCGTGGGCTGGAACAGCAACCTGATCTGCGGCGACATGAGCATCCAGA
CCACGCTGCGCAACCAGCTCAACGGCGTCACCAACGGCTTTCAGCAGATCATGAGCAACGTGATCCAGAG
CGCCACCAGCGCGGTGGCATCGCTGCCTGCGCTGATCATCCAGCGCGCCGATCCCGGCCTGTACAACCTG
CTGACCAACGGCGTGCTGCAGGCGCGCCTGGATTTCGACCGATCCAAGCTGACCTGCCGTGCCATGGCCG
AGAAGATGGCCGACACGGCGGGCGGACAACTCGGCTGGAGCCAGATGGCCGAAGGCATGGCACTGCGCGA
TGCGGTGTCGAGCACGGATGCCGTGTCGGCAATTGAACAGGCGGAGACGCGCCGCGGCAACGACGGCGTG
CCTTGGGTGGGTGGTAGCAATGCGGGCGGCGCAGGCCAGTCGGCCATCCGCGTGGTCGGCGACGTCACCC
GCGCAGGCTACAACCTGGTCAACGGCCGCAGCGTGACCGACACATCGTCCATCGCTGCCGCCAGTTGCGC
GAGTCTGTCTTGCCAGACCTGGACCTCGCCACAGCAGGCGACCGAATGGGCCACACGGGTTCTCGGCGAA
CAGGTGCAGCGCACTTGCGATGCCTGCACCAAGACCGAAACGGTGCCCGGCGTCGGGCTGACGCCGCTGA
TCCAGGAGGAGTACGAGGCAAAGCTGGAAGCCTTGCAGGAACTGGTCTCGGGAACGCGCAACACCACCTT
CGAGAACCTGCGTGCGGCTGGCAGCACCTCGCTGCCCATCACACGCGGCGTCATCGAGGCGCTGCGCGAC
GAGCCGGATCAAGACCTGCTGGCGCGGCGCCTGGCCTCGGAGGTCGCGCTGGCGTCGGTGCTGGAGAAGG
CATTGCTGCTCCAGCGCACCCTGCTGACCGGCAAGAAGGAGCCCAACGTCGCGGCGAACCAGTTGGCGGT
CGAGGCCGTGAACCACGAGAGCGACACGCTCGACCAGGAAATCCGCAACCTCAAGACCGAGCTGGAGCTG
CGCCGCGAGCTGGCGAACAACTCCCCCATGGCCATCATCCAGCGCCACGGCACGCGCGCGGCTGGCTCGC
GTGGCATCTACGAAGGCGATCCCATTCCCGACCGCCTTGACCGGCTCCAGAAGGGCAATCCGGGAGGCAA
CCCATGA
 Primer design