SecReT4
Protein ID: 160899620
T4SS name [ID]Tfc [712]
Gene symbol-
Locus tagDaci_4186
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]4576423..4577946 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDA9C313
KEGG IDdac:Daci_4186
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 5.2e-126, Aligned region: 10..492
Protein Sequence: 507 a.a.     [Download]
>gi|160899620|ref|YP_001565202.1| hypothetical protein Daci_4186 [Delftia acidovorans SPH-1]
MTLFTTDYLEYYLTLVSWIVHNGIWAVLVASGVFALPFIAIIVQEWLKARAEGADEGNKGVLSAARIENR
VFVAIVVVMFAGIPFIDVDLNTIRYDSSRSAQCQVSVPQPTDTGWSQSFSTINNQSAKVPVWWAFMHTLS
RAVTGASVAAIPCGTDLRQMRMEIDATRIDNPVLAQEVADFSRDCYGPARAKLFMQRPNLDEAQMHDVTW
IGSRFFTDTGGYYDTYRSSTPRDDWPYDSNRDAGLAQVASGGGYPSCRQWWADGSNGLRARLLGQVNPSL
LNRLAGWAGFLTRADVDDSVIRTIASPRQQKLNQGSVYTDYGGQIDKTLPNIVTRATGDVGMAFGAIAAF
PAMDVVRQALPMVLALLKMALVICIPLVLVVGTYDLKTVVTVSVVQFALFFVDFWFQLARWIDSTILDAL
YGWGFGWNRPHSNFDPLVGLNNAFGDMLLMFVTGTMFIVLPTFWIMALAWAGVRAGNVLQGLAGATGDAK
AAGGKGGSTAISAVPKK
 
Nucleotide Sequence: 1524 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4576423-4577946 Delftia acidovorans SPH-1 chromosome, complete genome
ATGACGCTTTTCACCACCGACTACTTGGAGTACTACCTGACGCTGGTGTCGTGGATCGTCCATAACGGCA
TCTGGGCCGTGCTGGTGGCGAGCGGTGTATTCGCGTTGCCTTTCATTGCCATCATCGTGCAGGAGTGGCT
GAAGGCCCGCGCGGAAGGCGCCGACGAAGGCAACAAGGGCGTGCTCTCGGCTGCGCGCATCGAGAACCGG
GTCTTCGTCGCCATCGTGGTGGTGATGTTCGCCGGCATCCCATTCATCGACGTGGATCTCAACACCATCC
GCTACGACAGCTCGCGCTCGGCCCAATGCCAGGTCAGCGTGCCGCAGCCCACCGATACCGGCTGGTCGCA
GTCCTTCAGCACTATCAACAACCAGTCGGCGAAGGTGCCCGTCTGGTGGGCCTTTATGCACACACTCTCG
CGAGCAGTGACCGGTGCCTCTGTGGCGGCGATTCCCTGCGGCACCGACTTGCGGCAGATGCGCATGGAGA
TCGACGCGACCCGCATCGACAACCCGGTGCTGGCTCAGGAAGTGGCGGATTTCTCGCGCGACTGCTACGG
ACCGGCGCGCGCCAAACTCTTCATGCAGCGCCCGAACCTCGATGAGGCGCAGATGCACGACGTGACCTGG
ATCGGCTCGCGCTTCTTCACTGACACGGGCGGCTACTACGACACCTACCGCTCCAGCACACCACGCGATG
ACTGGCCTTACGACAGCAACCGTGATGCTGGGCTTGCGCAGGTGGCCAGCGGTGGCGGCTATCCGTCCTG
CAGGCAGTGGTGGGCCGATGGCAGCAATGGCCTGCGTGCACGCCTGCTGGGGCAGGTAAACCCAAGCCTG
CTGAATCGCCTGGCGGGCTGGGCCGGATTCCTGACCCGTGCCGATGTGGACGACTCGGTGATCCGCACCA
TCGCCTCGCCGAGGCAGCAGAAACTGAACCAGGGCAGCGTCTATACGGACTACGGCGGTCAGATCGACAA
GACCCTGCCGAACATCGTAACGCGGGCCACGGGCGACGTCGGCATGGCTTTCGGCGCGATTGCCGCGTTT
CCCGCCATGGACGTGGTGCGCCAGGCGCTGCCTATGGTGCTCGCCTTGCTCAAGATGGCGCTGGTCATCT
GCATCCCGCTGGTGCTGGTCGTGGGCACCTACGACCTGAAGACCGTCGTTACCGTGAGCGTCGTGCAGTT
CGCGCTATTCTTCGTCGATTTCTGGTTCCAGCTCGCGCGCTGGATCGACAGCACCATCCTCGATGCGCTC
TACGGCTGGGGCTTCGGCTGGAACCGGCCACACAGCAACTTCGACCCGCTGGTGGGGCTGAACAACGCCT
TTGGCGACATGCTCCTGATGTTCGTCACGGGAACGATGTTTATTGTGCTGCCTACGTTCTGGATCATGGC
CCTGGCTTGGGCGGGCGTTCGCGCCGGTAACGTCTTACAAGGCCTGGCTGGAGCTACCGGAGATGCCAAG
GCCGCTGGCGGAAAGGGAGGAAGTACCGCAATCAGCGCGGTGCCGAAGAAGTGA
 Primer design