SecReT4
Protein ID: 16119337
T4SS name [ID]VirB [218]
Gene symboltraG
Locus tagAtu5108
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid At [GenBank: NC_003064] [Browse all T4SS(s) in this replicon]
Location [Strand]113538..115457 [-]
Productconjugal transfer coupling protein TraG
Component typeVirD4
UniProt IDA9CLN6
KEGG IDatu:Atu5108
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7e-94, Aligned region: 166..633
TraG-D_C [PF12696], Evalue: 5.3e-29, Aligned region: 473..596
TrwB_AAD_bind [PF10412], Evalue: 1.9e-21, Aligned region: 430..612
Protein Sequence: 639 a.a.     [Download]
>gi|16119337|ref|NP_396043.1| conjugal transfer protein [Agrobacterium tumefaciens str. C58]
MKGKAKQHPSLLLITIPIAVTGFSFYVAHWRWPELAAGITGKTQYWFLRASPLPVLLFGPLAGLLAVWAL
PLHRRRPVALASFLCFFLVAGFYGMREFGRLQPLVESGVLTWDQALSFVDMIAVVGAAMGFMAAAVAARI
SSVVPEQVTRARRGTFGDADWLPMSAAARLFPDDGEIVIGERYRVDKELIHELPFDPNDPATWGRGGKAP
LLTYAQDFDSTHMLFFAGSGGFKTTSNVVPTALRYTGPLICLDPSTEVAPMVVDHRRDKLDREVVVLDPA
NPVMGFNVLDGIEHSLKKEEDIVGIAHMLLSESVRFESSTGSYFQSQAHNLLTGLLAHVMLSPEYAGQRN
LRSLRQIVSEPENSVLAMLRDVQEHSASAFIRETLGVFVNMTEQTFSGVYSTASKDTQWLSLDNYAALVC
GNTFKSSEIAGGKKDVFINIPASILRSYPGIGRVIIGSLINAMIEADGAFTRRALFILDEVDLLGYMRVL
EEARDRGRKYGVSMMLMYQSVGQLERHFGKDGAVSWIDGCAFASYAAIKALDTARNVSAQCGEMTVEVKG
SSRNLGWGTKNSASRKSENINFQRRPLIMPHEITQSMRKDEQIIIVQGHSPIRCGRAIYFRRKDMDMHAR
PNRFAKLGP
 
Nucleotide Sequence: 1920 bp     [Download]
>gi|159186452|ref|NC_003064.2|:c115457-113538 Agrobacterium tumefaciens str. C58 plasmid At, complete sequence
ATGAAGGGAAAGGCCAAACAGCATCCGAGCCTGTTGCTTATCACCATTCCCATCGCCGTCACCGGATTTT
CCTTTTACGTCGCCCACTGGCGTTGGCCTGAATTGGCGGCCGGCATCACAGGCAAGACGCAATACTGGTT
CCTTCGGGCGTCACCGTTGCCCGTCCTTTTGTTCGGGCCGCTGGCTGGATTGCTGGCAGTTTGGGCGCTG
CCCCTCCATCGGCGAAGGCCCGTGGCATTGGCAAGCTTTCTATGCTTTTTCCTGGTGGCCGGCTTTTACG
GGATGCGCGAGTTCGGTCGGCTTCAGCCGCTCGTAGAGAGCGGTGTGCTGACCTGGGATCAGGCGCTATC
ATTCGTTGACATGATTGCGGTCGTTGGCGCAGCGATGGGGTTCATGGCGGCCGCGGTCGCGGCGCGCATC
TCCAGCGTCGTGCCCGAACAGGTGACGCGCGCCAGGCGCGGAACATTCGGAGATGCAGACTGGCTGCCGA
TGTCGGCGGCGGCACGGCTGTTTCCCGATGATGGCGAAATCGTCATCGGTGAGCGCTACAGGGTCGACAA
GGAACTCATCCATGAGCTGCCGTTCGATCCGAACGATCCGGCTACCTGGGGACGTGGTGGCAAAGCCCCG
CTGCTGACCTACGCCCAGGATTTCGATTCGACCCACATGCTTTTCTTCGCAGGCTCTGGTGGCTTCAAGA
CCACCAGCAACGTCGTGCCGACGGCGCTCAGATATACGGGTCCGCTCATTTGCCTGGATCCGTCCACCGA
GGTAGCCCCGATGGTCGTTGACCATCGAAGAGATAAACTCGACCGAGAGGTTGTTGTGCTCGATCCGGCA
AATCCGGTCATGGGATTTAACGTGCTCGACGGCATCGAGCACTCGCTAAAAAAGGAAGAGGACATTGTCG
GCATCGCGCACATGTTACTCTCGGAAAGCGTGCGCTTCGAATCGTCGACTGGCTCTTACTTCCAATCGCA
GGCGCACAATCTGCTGACTGGTCTTCTGGCGCATGTGATGCTGTCACCGGAATATGCAGGACAGCGAAAT
CTGCGCAGCCTGCGCCAGATCGTCTCCGAGCCGGAAAACTCCGTGCTCGCCATGCTGCGCGACGTACAGG
AACACTCCGCGTCCGCCTTCATCCGCGAAACGCTCGGCGTCTTTGTTAACATGACCGAGCAAACGTTCTC
AGGCGTCTATTCGACGGCATCGAAGGATACGCAATGGCTGTCGCTCGATAATTACGCGGCACTGGTTTGC
GGCAACACGTTCAAATCGAGCGAGATCGCTGGCGGAAAGAAAGACGTCTTTATCAATATCCCCGCATCGA
TCCTGCGGTCCTATCCCGGTATCGGTCGGGTGATCATCGGCTCGCTGATCAACGCGATGATCGAAGCGGA
TGGTGCGTTCACGAGGCGAGCGTTGTTCATTTTGGACGAAGTCGATCTGCTTGGCTACATGCGCGTGCTT
GAAGAGGCGCGCGATCGCGGTCGCAAGTATGGCGTCAGCATGATGCTGATGTACCAATCCGTCGGGCAAC
TGGAACGGCACTTCGGAAAAGACGGTGCGGTGTCGTGGATCGACGGCTGCGCTTTCGCGAGTTACGCCGC
GATCAAGGCACTGGATACCGCCCGCAACGTCTCAGCCCAATGTGGAGAAATGACTGTCGAAGTCAAAGGC
AGTTCTCGCAATCTCGGCTGGGGTACGAAAAACAGCGCATCGCGGAAATCAGAAAACATCAATTTCCAGC
GCCGGCCGCTCATTATGCCGCACGAAATCACACAATCGATGCGCAAGGACGAGCAGATCATTATCGTCCA
GGGCCACAGTCCGATCCGCTGCGGACGGGCGATCTATTTCAGGCGGAAGGACATGGATATGCACGCCAGG
CCCAACAGGTTTGCCAAGCTGGGACCTTGA
 Primer design