SecReT4
Protein ID: 16119387
T4SS name [ID]VirB [218]
Gene symbolavhB2
Locus tagAtu5163
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid At [GenBank: NC_003064] [Browse all T4SS(s) in this replicon]
Location [Strand]161191..161490 [+]
Producttype IV secretion protein AvhB2
Component typeVirB2
UniProt IDQ7D3S1
KEGG IDatu:Atu5163
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-23, Aligned region: 11..96
Protein Sequence: 99 a.a.     [Download]
>gi|16119387|ref|NP_396093.1| type IV secretion protein AvhB2 [Agrobacterium tumefaciens str. C58]
MIISSRIRPVVASSVMAVAIIVTMVEPAFAQSAGIETVLQNIVDMLTGNIAKLLAVIAVIVICIAWMFGY
MDLRRAGFWIIGIGGIFGATELVNTIVGA
 
Nucleotide Sequence: 300 bp     [Download]
>gi|159186452|ref|NC_003064.2|:161191-161490 Agrobacterium tumefaciens str. C58 plasmid At, complete sequence
ATGATAATCAGTTCCCGGATCAGACCCGTCGTCGCTTCGTCCGTCATGGCCGTCGCCATTATAGTGACGA
TGGTTGAGCCCGCCTTCGCGCAATCCGCCGGCATCGAGACCGTCCTGCAGAACATCGTTGACATGCTGAC
GGGAAACATTGCGAAGCTTCTCGCTGTGATTGCGGTCATCGTCATCTGCATCGCCTGGATGTTTGGTTAC
ATGGACCTGAGGCGAGCGGGCTTCTGGATCATCGGAATTGGCGGCATCTTTGGCGCCACCGAACTCGTCA
ACACCATCGTCGGAGCCTGA
 Primer design