SecReT4
Protein ID: 16119388
T4SS name [ID]VirB [218]
Gene symbolavhB3
Locus tagAtu5164
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid At [GenBank: NC_003064] [Browse all T4SS(s) in this replicon]
Location [Strand]161493..161834 [+]
Producttype IV secretion protein AvhB3
Component typeVirB3
UniProt IDQ7D3S0
KEGG IDatu:Atu5164
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 5.5e-20, Aligned region: 10..93
Protein Sequence: 113 a.a.     [Download]
>gi|16119388|ref|NP_396094.1| type IV secretion protein AvhB3 [Agrobacterium tumefaciens str. C58]
MVGGQTVFEEDTLFVACTRPAMIAGVTMEAMGFNIMVTTILYIIAGSIAYAFVGIVFHLIFKALVKHDHN
MFRILLAWVETRGRSRNGAYWGGATLSPLRLTRRFDERDIGIA
 
Nucleotide Sequence: 342 bp     [Download]
>gi|159186452|ref|NC_003064.2|:161493-161834 Agrobacterium tumefaciens str. C58 plasmid At, complete sequence
ATGGTAGGCGGACAAACGGTTTTCGAAGAAGACACACTCTTCGTCGCGTGCACGCGTCCCGCGATGATTG
CCGGTGTTACGATGGAGGCGATGGGCTTCAACATCATGGTCACGACGATCCTATACATCATCGCCGGATC
TATCGCCTACGCGTTCGTCGGCATCGTTTTCCATCTCATCTTCAAAGCGCTCGTCAAGCACGATCACAAC
ATGTTCCGCATCCTGCTCGCCTGGGTCGAGACACGCGGCCGCTCGCGCAACGGTGCCTATTGGGGCGGGG
CAACACTTTCCCCCCTGAGACTGACACGCCGCTTCGACGAAAGGGATATTGGAATTGCCTGA
 Primer design