SecReT4
Protein ID: 16119390
T4SS name [ID]VirB [218]
Gene symbolavhB5
Locus tagAtu5166
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid At [GenBank: NC_003064] [Browse all T4SS(s) in this replicon]
Location [Strand]164208..164906 [+]
Producttype IV secretion protein AvhB5
Component typeVirB5
UniProt IDA9CLM0
KEGG IDatu:Atu5166
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 6.1e-54, Aligned region: 26..218
Protein Sequence: 232 a.a.     [Download]
>gi|16119390|ref|NP_396096.1| type IV secretion protein AvhB5 [Agrobacterium tumefaciens str. C58]
MTSYRLHGVLLSAVLMLAAEGVSGQGIPVNDQAAIAKQIESIAQLKSQLDALNEQIGQARQLYGSLNKLT
DMADVAEVLNDPAIRKALPFDFAAIEGLLKGNGTGVFGDSASRFLEGNSTYRTDADDFYARELSRLQNKN
AGQMSVGEQIYDAGTKRIDGIDQLRGKISTAGDAKEIADLQARLQVEQAFLQTDVLRMEGLRMVQEAQNQ
VDEQRKAEDWRQRMDNMKAALQ
 
Nucleotide Sequence: 699 bp     [Download]
>gi|159186452|ref|NC_003064.2|:164208-164906 Agrobacterium tumefaciens str. C58 plasmid At, complete sequence
ATGACTTCCTATCGACTTCATGGCGTACTGCTCAGCGCGGTGCTTATGCTTGCTGCTGAAGGCGTGTCAG
GGCAGGGGATTCCTGTCAACGATCAGGCTGCGATTGCCAAGCAGATCGAGAGCATCGCTCAGCTCAAGTC
GCAACTCGACGCGCTCAATGAGCAGATCGGCCAGGCTCGGCAGCTTTATGGCTCGCTCAACAAGCTGACC
GATATGGCGGATGTCGCCGAGGTTCTCAACGATCCGGCGATCCGCAAGGCGCTTCCCTTTGACTTCGCTG
CCATCGAGGGATTGCTCAAAGGCAACGGCACCGGCGTGTTCGGTGATTCCGCCTCAAGGTTTCTGGAAGG
TAACTCGACCTACCGCACTGACGCCGATGATTTCTACGCTCGGGAATTGTCACGGCTTCAGAACAAGAAT
GCCGGGCAAATGAGCGTTGGTGAGCAAATCTACGATGCCGGGACCAAGCGCATCGACGGGATTGATCAGC
TGCGGGGAAAGATTTCCACGGCTGGCGACGCCAAAGAGATTGCCGACCTGCAGGCTCGGCTACAGGTCGA
ACAGGCATTTCTTCAGACCGACGTCCTGCGGATGGAGGGGCTGAGGATGGTGCAGGAGGCGCAGAACCAG
GTCGACGAACAGCGCAAGGCGGAGGACTGGCGCCAACGGATGGACAATATGAAGGCGGCGCTGCAGTGA
 Primer design