SecReT4
Protein ID: 16119392
T4SS name [ID]VirB [218]
Gene symbolavhB7
Locus tagAtu5168
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid At [GenBank: NC_003064] [Browse all T4SS(s) in this replicon]
Location [Strand]166112..166378 [+]
Producttype IV secretion protein AvhB7
Component typeVirB7
UniProt IDQ7D3R6
KEGG IDatu:Atu5168
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 88 a.a.     [Download]
>gi|16119392|ref|NP_396098.1| type IV secretion protein AvhB7 [Agrobacterium tumefaciens str. C58]
MIKPALLIIFSATLVGCASMTYPLPNCDGYSRRPLNRPMWDWEGGSKLQQQQSNTSSSTSLTPFVKEASE
TSAFAHLDIDGSYRRCEG
 
Nucleotide Sequence: 267 bp     [Download]
>gi|159186452|ref|NC_003064.2|:166112-166378 Agrobacterium tumefaciens str. C58 plasmid At, complete sequence
ATGATTAAGCCTGCCCTGTTGATCATCTTTTCAGCCACGCTTGTCGGCTGCGCTTCGATGACCTACCCAT
TGCCGAACTGCGACGGCTATTCGCGCCGCCCATTGAACCGCCCGATGTGGGACTGGGAGGGCGGCAGCAA
GCTGCAACAGCAGCAATCCAACACGAGTTCGTCCACGTCCCTCACACCTTTCGTAAAAGAGGCCAGCGAG
ACTTCCGCTTTTGCGCATCTGGACATCGACGGTTCCTATCGCCGCTGTGAGGGATGA
 Primer design