SecReT4
Protein ID: 16119393
T4SS name [ID]VirB [218]
Gene symbolavhB8
Locus tagAtu5169
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid At [GenBank: NC_003064] [Browse all T4SS(s) in this replicon]
Location [Strand]166382..167053 [+]
Producttype IV secretion protein AvhB8
Component typeVirB8
UniProt IDQ7D3R5
KEGG IDatu:Atu5169
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 7.3e-67, Aligned region: 13..220
Protein Sequence: 223 a.a.     [Download]
>gi|16119393|ref|NP_396099.1| type IV secretion protein AvhB8 [Agrobacterium tumefaciens str. C58]
MATTDNLKSYFDKARRFDQDRMIQVERSKRIAWSIAIVSGIVAAVAVFAVACLTPLKTVEPFVVRVDNST
GIVDVVSALTSTAGTYDEAVTKYFAAKYVRAREGYVWSEAQENFRTIALLSTQAEQTRFAALYRGSNPQS
PQNTYGRGATARIDIASISLINQNVVSVRYMRTITRGEEVRTTHWVASITYSYANAPMSSTDRLVNPLGF
VVSEYRADPEEVR
 
Nucleotide Sequence: 672 bp     [Download]
>gi|159186452|ref|NC_003064.2|:166382-167053 Agrobacterium tumefaciens str. C58 plasmid At, complete sequence
ATGGCGACGACAGATAATCTCAAGAGCTACTTCGACAAAGCACGTCGTTTCGACCAGGACCGGATGATCC
AGGTCGAGCGATCGAAGAGGATTGCCTGGTCGATCGCCATAGTTTCAGGCATTGTCGCCGCTGTAGCCGT
CTTCGCGGTCGCGTGTCTCACACCCCTCAAGACGGTTGAACCCTTTGTGGTGCGCGTCGACAATTCGACC
GGCATTGTCGACGTCGTGTCAGCGCTGACATCGACGGCTGGCACCTACGATGAGGCGGTGACGAAATATT
TCGCTGCAAAATATGTCCGGGCCCGCGAGGGTTACGTCTGGAGTGAAGCACAGGAAAATTTCCGCACCAT
CGCCCTCTTGTCGACGCAAGCGGAGCAAACGCGTTTCGCGGCCCTCTACCGTGGCAGCAACCCGCAATCG
CCCCAGAATACTTATGGTCGCGGGGCTACAGCAAGGATCGATATCGCTTCAATCTCCCTCATCAATCAGA
ATGTCGTTTCCGTACGCTACATGCGAACCATCACGCGTGGCGAGGAAGTACGAACGACCCATTGGGTTGC
GTCGATCACCTATTCCTACGCGAACGCTCCGATGTCCTCGACGGACCGGCTCGTAAACCCGCTCGGTTTC
GTCGTCAGCGAGTATCGCGCTGATCCGGAGGAGGTGAGATGA
 Primer design