SecReT4
Protein ID: 16119395
T4SS name [ID]VirB [218]
Gene symbolavhB10
Locus tagAtu5171
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid At [GenBank: NC_003064] [Browse all T4SS(s) in this replicon]
Location [Strand]167919..169091 [+]
Producttype IV secretion protein AvhB10
Component typeVirB10
UniProt IDQ7D3R3
KEGG IDatu:Atu5171
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.7e-60, Aligned region: 183..357
Protein Sequence: 390 a.a.     [Download]
>gi|16119395|ref|NP_396101.1| type IV secretion protein AvhB10 [Agrobacterium tumefaciens str. C58]
MAQEDEDRIPGERAETVTSRQIDNSPLLKRGAVAIAIIAFVSFALWSTTGKKGRDENVQPERIIIRQTTP
FEAAKEKVEPDQALPEVKLPTPVVEPVIEEQDKLLDSARRAPVMAFSGGQRNRKELREGDSSYPSDNSNF
VPLDNNMSVQNQQNNEQQSFDGLLRPTRLEGSRAGTLGNRNFIVAMGTTIPCVLETALASDQPGFTTCVI
NRDVLSDNGRVVLMEKGTQVVGEYRGGLQRGQERLFILWNRAKTPKGVIVTLASPATDALGRAGVDGHVD
THWWERFGSALLLSIVGDATNYASSRLQDSDVDAQKTTSASQQAAAIAVEQSINIPPTLNKHQGEPVSIF
VARDLDFSGIYGLRVTEPRNRVFDRAVLGDFAPRSTLLTK
 
Nucleotide Sequence: 1173 bp     [Download]
>gi|159186452|ref|NC_003064.2|:167919-169091 Agrobacterium tumefaciens str. C58 plasmid At, complete sequence
ATGGCTCAGGAAGACGAGGATCGCATCCCCGGAGAGCGTGCCGAAACCGTCACCAGTCGTCAGATCGACA
ACAGCCCTCTCTTGAAACGCGGCGCTGTTGCCATTGCGATCATCGCGTTTGTCAGCTTCGCGCTTTGGTC
GACGACGGGAAAGAAGGGAAGGGATGAAAATGTTCAGCCCGAACGGATCATTATTCGTCAGACGACCCCC
TTCGAGGCCGCAAAAGAGAAAGTTGAACCGGACCAGGCGCTCCCTGAAGTAAAATTGCCAACGCCTGTCG
TCGAACCGGTCATTGAAGAGCAGGATAAGCTGCTCGATTCCGCCCGCCGCGCGCCCGTGATGGCCTTCAG
TGGAGGGCAGAGGAATCGGAAAGAGCTGAGGGAAGGTGACAGCTCTTATCCTTCCGACAACAGCAATTTC
GTGCCGCTCGACAACAATATGTCTGTTCAGAACCAGCAAAACAATGAGCAGCAGAGTTTCGATGGCCTGC
TGCGGCCAACGCGGCTTGAAGGCTCAAGGGCCGGTACACTCGGAAACCGCAATTTCATCGTCGCGATGGG
AACGACCATTCCCTGCGTTCTTGAAACCGCGTTAGCATCCGACCAGCCGGGTTTTACCACTTGTGTGATC
AACCGCGATGTTCTCTCTGACAATGGCAGGGTGGTCTTGATGGAAAAGGGCACGCAGGTTGTCGGCGAAT
ATCGTGGAGGGCTTCAACGCGGGCAAGAGCGCCTGTTCATTCTCTGGAATCGCGCGAAAACGCCGAAGGG
CGTTATCGTCACTCTCGCATCACCAGCAACCGACGCACTGGGTCGTGCCGGTGTCGACGGCCATGTCGAC
ACCCATTGGTGGGAGCGGTTCGGCAGCGCTCTTCTGCTTTCCATTGTCGGGGACGCGACGAACTATGCAA
GCAGTCGGCTGCAGGACAGCGATGTCGACGCGCAAAAAACAACGAGTGCCAGTCAACAGGCGGCCGCCAT
CGCGGTCGAGCAGTCCATCAATATCCCGCCGACACTCAATAAGCACCAAGGTGAACCGGTTTCGATCTTT
GTCGCTCGCGATCTCGACTTTTCCGGCATCTACGGTCTTCGGGTGACCGAACCCAGAAACCGCGTTTTCG
ATCGTGCAGTCCTGGGGGATTTCGCGCCACGATCGACGCTCCTAACGAAATAG
 Primer design