SecReT4
Protein ID: 16119396
T4SS name [ID]VirB [218]
Gene symbolavhB11
Locus tagAtu5172
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid At [GenBank: NC_003064] [Browse all T4SS(s) in this replicon]
Location [Strand]169100..170110 [+]
Producttype IV secretion protein AvhB11
Component typeVirB11
UniProt IDQ7D3R2
KEGG IDatu:Atu5172
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.1e-82, Aligned region: 15..317
Protein Sequence: 336 a.a.     [Download]
>gi|16119396|ref|NP_396102.1| type IV secretion protein AvhB11 [Agrobacterium tumefaciens str. C58]
MSERQESAVVSELLKPFSTFLQDKSLLEVIVNRPGQVLTEGPGGWRTYEMPELTFEKLMRLARAVASFSH
QSIDETRPILSATLPGNERIQIVIPPATINDTVSMTIRKPSSVDFSLDDLEEKGFFQTACAATSTSSSAQ
DEELCETYRAGRFKDFLRQAVIARKNIIISGATGSAKTTLSKALIKHIPENERVISIEDTPELVISQPNH
VRLFYSKGRQGLSRAGPKELLESCLRMRPDRILLQELRDGTAFYYIRNVNSGHPGSITTVHANSAELAFE
QLVLLVKESEGVAGLDRADIVALLKASIDIVAQCRRNKGNFRLSEVYFRCERKAKD
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|159186452|ref|NC_003064.2|:169100-170110 Agrobacterium tumefaciens str. C58 plasmid At, complete sequence
ATGTCAGAGAGGCAAGAATCGGCTGTCGTCAGCGAGCTGTTGAAGCCGTTTTCGACATTCCTTCAGGACA
AGTCTCTCCTAGAGGTGATTGTCAATCGGCCCGGGCAGGTGTTGACGGAAGGTCCCGGTGGGTGGCGGAC
CTATGAAATGCCGGAGCTGACCTTCGAAAAGCTCATGCGTCTTGCCCGGGCAGTCGCAAGTTTTTCCCAT
CAGTCGATTGATGAGACGCGTCCAATATTGTCGGCGACGCTACCCGGGAACGAACGAATCCAGATCGTCA
TCCCCCCGGCGACCATCAATGACACTGTCAGCATGACAATCCGCAAGCCTTCTTCGGTCGACTTCAGTCT
TGATGATCTGGAGGAAAAGGGATTTTTCCAGACAGCGTGCGCAGCGACCAGTACCTCCTCCTCCGCGCAG
GATGAGGAACTGTGTGAAACATATCGTGCCGGCCGTTTTAAGGATTTCCTGCGGCAGGCCGTCATCGCTC
GAAAAAACATCATCATTTCTGGCGCCACAGGTTCGGCGAAAACGACACTTTCCAAAGCATTGATCAAGCA
TATTCCCGAAAACGAGAGGGTCATTTCAATCGAGGACACTCCCGAGCTCGTTATCTCACAACCGAACCAC
GTGCGCTTGTTCTACTCGAAAGGACGGCAGGGGCTTTCGCGTGCCGGACCGAAAGAGCTTCTCGAATCCT
GTCTTCGTATGCGGCCGGATAGGATTCTGCTTCAGGAGCTTCGCGATGGGACGGCCTTTTATTATATCCG
GAACGTGAATTCAGGCCATCCTGGCTCAATAACCACGGTCCATGCGAACTCGGCCGAATTGGCTTTTGAG
CAGCTGGTCCTCCTCGTCAAGGAATCGGAGGGCGTTGCAGGCTTGGATCGGGCCGACATCGTGGCTTTGT
TGAAGGCGAGTATCGATATCGTCGCCCAGTGCAGGAGAAACAAAGGAAACTTTCGGCTGTCTGAGGTTTA
TTTCAGGTGTGAGCGTAAAGCCAAGGACTAG
 Primer design