SecReT4
Protein ID: 16119847
T4SS name [ID]Trb [245]
Gene symboltrbL
Locus tagAtu6035
StrainAgrobacterium tumefaciens str. C58
Repliconplasmid Ti [GenBank: NC_003065] [Browse all T4SS(s) in this replicon]
Location [Strand]44924..46120 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDO66175, Q7D2P7
KEGG IDatu:Atu6035
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.9e-30, Aligned region: 67..279
Protein Sequence: 398 a.a.     [Download]
>gi|16119847|ref|NP_396552.1| conjugal transfer protein [Agrobacterium tumefaciens str. C58]
MVVVRPSRRLEMTFIVMAIVLLATAPAFAQQGTVLTTLENQVVTAAKGWETTILNAARSLFWILAGIEIG
IAAVWLAINAASLDAWFAELVRRIMFIGLFAFILERGPALAKAVVDSLFQIGAGGGSASPANIFDAGIRV
ASKMSEQAKFGLFEDNALAIAAVFAMVVVVVSFSLVAAIFVAVMVEMYVGLLAGMIMLGLGGSSYTKDFA
VRYLVYAFSVGMKLMALVMIAKIGSDILIGLAEAPTATSDQFITTLAIAGISVVVFVIAMYVPPIIQGVV
QGASVSGGMEAIRHGGQTAAFAAGGAFLGAGAAMKGAQSASTARAEGSSMAGAALRGMASGIGNAGWAAG
SAAKEKAIASPGAYAGSLLGLANAKLDQTRQSGRPSAPPPPPPVNENK
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|159161952|ref|NC_003065.3|:c46120-44924 Agrobacterium tumefaciens str. C58 plasmid Ti, complete sequence
ATGGTAGTCGTTCGTCCCTCTCGCCGCCTGGAAATGACCTTCATCGTGATGGCAATCGTACTGCTTGCGA
CCGCGCCGGCCTTCGCCCAGCAAGGCACGGTCCTGACCACATTGGAAAACCAGGTGGTCACCGCCGCCAA
GGGCTGGGAGACGACGATCCTGAACGCGGCCCGATCGTTGTTCTGGATCCTCGCCGGAATCGAGATCGGC
ATCGCCGCCGTCTGGCTCGCAATCAACGCCGCGTCGCTTGATGCCTGGTTCGCCGAGCTTGTCCGCCGCA
TCATGTTCATCGGCCTTTTCGCCTTTATCCTCGAGCGCGGCCCGGCGTTGGCGAAGGCGGTGGTCGACAG
CCTGTTCCAGATCGGCGCCGGTGGCGGCTCGGCCTCGCCCGCCAACATCTTCGATGCCGGCATCCGCGTC
GCCTCGAAAATGTCCGAGCAGGCGAAGTTCGGCCTGTTCGAGGACAACGCGCTCGCCATCGCGGCGGTCT
TTGCGATGGTCGTGGTCGTCGTCTCCTTCTCATTGGTGGCCGCAATCTTTGTGGCGGTCATGGTGGAGAT
GTATGTCGGGCTTCTGGCAGGAATGATCATGCTCGGGCTGGGTGGCTCGTCCTACACCAAGGATTTTGCG
GTCCGGTATCTCGTCTACGCCTTCTCGGTCGGCATGAAGCTGATGGCTCTGGTGATGATCGCCAAGATCG
GTTCGGACATCCTGATCGGACTGGCCGAGGCGCCGACGGCAACCTCCGACCAGTTTATCACGACACTTGC
CATCGCCGGCATATCGGTCGTCGTGTTCGTCATCGCCATGTACGTGCCGCCGATCATCCAGGGCGTCGTC
CAGGGTGCATCGGTCTCGGGCGGCATGGAGGCAATCCGCCACGGTGGTCAGACGGCCGCCTTCGCCGCCG
GCGGCGCTTTCCTTGGCGCAGGCGCCGCGATGAAAGGGGCGCAATCGGCAAGTACGGCGAGGGCTGAGGG
CTCATCGATGGCCGGGGCGGCGCTCCGTGGCATGGCGTCCGGCATCGGCAACGCCGGATGGGCGGCGGGC
TCGGCAGCAAAGGAGAAGGCGATTGCCTCGCCCGGTGCCTATGCCGGCTCGCTGCTCGGTCTCGCCAACG
CCAAGCTCGACCAGACGCGGCAATCCGGCAGGCCCTCGGCGCCTCCTCCGCCTCCACCCGTCAACGAAAA
CAAATAA
 Primer design