SecReT4
Protein ID: 16126655
T4SS name [ID]VirB [400]
Gene symbol-
Locus tagCC_2416
StrainCaulobacter crescentus CB15
Repliconchromosome [GenBank: NC_002696] [Browse all T4SS(s) in this replicon]
Location [Strand]2622042..2622698 [+]
Producttransglycosylase
Component typeVirB1
UniProt IDQ9A5N1
KEGG IDccr:CC_2416
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 218 a.a.     [Download]
>gi|16126655|ref|NP_421219.1| transglycosylase [Caulobacter crescentus CB15]
MEDTLGELVRRSVRSRSAPGLAWACGVAAIGLLCAARGHAQVLEIDDQGAVRRFDGPTQFLGDGPPVPLQ
AASRAERHRMGSDRTPTAPVKRLLEDAAQRSQISPDLLTAVARRESGLNPQARSAKGALGVMQLMPGTAK
DLAVDPLDPAANVDGGTRYLKTLLARYDGDVIKALAAYNAGMGAVDRHGGVPPFPETKAYVDAILEHMAQ
AVAPRRKP
 
Nucleotide Sequence: 657 bp     [Download]
>gi|16124256|ref|NC_002696.2|:2622042-2622698 Caulobacter crescentus CB15 chromosome, complete genome
ATGGAGGACACACTGGGGGAGTTGGTGCGCCGTTCTGTTCGATCCCGTTCAGCGCCTGGCCTGGCCTGGG
CCTGCGGCGTCGCCGCGATCGGCTTGCTTTGCGCCGCTCGGGGGCACGCTCAGGTCTTGGAGATCGACGA
CCAAGGCGCCGTTCGCCGCTTTGATGGTCCCACCCAATTCCTAGGCGATGGTCCGCCGGTTCCCCTTCAG
GCTGCTTCACGCGCCGAGCGTCATCGGATGGGAAGCGACCGCACGCCGACCGCGCCGGTCAAACGCCTCC
TCGAAGACGCAGCGCAGCGCTCACAGATCAGCCCCGACCTGTTGACCGCCGTCGCCCGTCGCGAATCCGG
ACTAAACCCGCAAGCGCGGTCCGCGAAGGGCGCGCTGGGCGTCATGCAGTTGATGCCTGGCACGGCCAAG
GACCTGGCCGTCGATCCGCTTGATCCCGCCGCCAATGTCGACGGCGGAACGCGTTACCTGAAAACACTTC
TGGCCCGCTATGACGGCGACGTCATCAAGGCCCTCGCCGCTTACAACGCGGGCATGGGCGCGGTGGACCG
TCACGGCGGCGTTCCCCCGTTTCCTGAGACCAAAGCCTATGTGGACGCCATTCTCGAGCACATGGCCCAG
GCCGTGGCGCCGCGCCGCAAGCCCTGA
 Primer design