SecReT4
Protein ID: 16126662
T4SS name [ID]VirB [400]
Gene symbol-
Locus tagCC_2423
StrainCaulobacter crescentus CB15
Repliconchromosome [GenBank: NC_002696] [Browse all T4SS(s) in this replicon]
Location [Strand]2628764..2629732 [+]
Producttype IV secretion system protein B11
Component typeVirB11
UniProt IDQ9A5M4
KEGG IDccr:CC_2423
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-90, Aligned region: 12..309
AAA_28 [PF13521], Evalue: 5.7e-05, Aligned region: 161..230
Zeta_toxin [PF06414], Evalue: 8.3e-05, Aligned region: 156..213
Protein Sequence: 322 a.a.     [Download]
>gi|16126662|ref|NP_421226.1| type IV secretion system protein B11 [Caulobacter crescentus CB15]
MSTGVYLAAYLAPLQPWLDRADVTDIWVNRPGEVWIETTKGVTSRLAAPDLTDQALQRLARQIAAASHQG
VSREQPLLSASLPNGARVQIIAPPATRGDLALAIRKHTLSDLSLSDLAIGGTLAPPALTGRADADAQLRA
LLSAGDVEGFLRTAIQRRKTIVLSGGTSSGKTTLLNALVKEIPAHERLVLIEDAPEIQLRHENAIGLIAA
RSDTGEAQVDAEDLLQASLRMRPDRILLGELRGREAFAFLRAVNTGHPGSITTVHADSPQGALDQIALLS
LLAGVDLGWDTVRNYVRQVVDIVVQLNRVGGGRKVTAVEFLC
 
Nucleotide Sequence: 969 bp     [Download]
>gi|16124256|ref|NC_002696.2|:2628764-2629732 Caulobacter crescentus CB15 chromosome, complete genome
ATGAGCACGGGGGTCTATCTCGCCGCCTACCTGGCGCCGCTGCAGCCTTGGCTGGACCGCGCTGACGTCA
CGGACATTTGGGTCAACCGGCCCGGCGAGGTATGGATCGAGACCACCAAGGGGGTGACCTCACGCCTCGC
TGCGCCGGACCTCACCGATCAGGCGTTGCAGCGTCTGGCCCGCCAGATCGCCGCCGCCAGCCACCAGGGC
GTCAGTCGCGAACAGCCGCTGCTCAGCGCCAGTCTGCCAAACGGCGCCCGCGTACAGATCATTGCGCCGC
CAGCCACGCGCGGCGACCTTGCCCTGGCCATCCGCAAACACACGCTCAGCGACCTCAGCCTCAGCGACCT
CGCCATCGGCGGGACCCTGGCGCCCCCGGCCTTGACCGGTCGGGCCGATGCGGACGCTCAGTTGCGCGCC
TTGCTGAGCGCCGGCGACGTCGAAGGTTTTCTTCGAACCGCCATCCAACGCCGCAAGACGATCGTCCTGT
CGGGCGGCACGTCCTCGGGCAAAACCACCTTGCTCAACGCTCTGGTCAAGGAGATCCCGGCGCACGAGCG
CCTCGTCCTGATCGAAGACGCCCCCGAAATCCAACTGCGTCACGAGAACGCGATCGGCCTGATCGCCGCG
CGCAGCGACACGGGTGAGGCCCAGGTCGACGCCGAGGATCTCCTTCAAGCCAGCCTGCGGATGCGCCCTG
ACCGGATCTTGCTGGGCGAGTTGCGCGGTCGTGAGGCCTTCGCTTTCCTACGGGCGGTCAATACCGGCCA
TCCCGGCTCCATCACCACGGTCCATGCCGATAGTCCGCAAGGCGCCCTGGATCAGATCGCGCTGCTTTCG
CTGCTCGCGGGCGTGGACCTAGGCTGGGACACAGTTCGCAACTATGTGCGCCAGGTCGTCGATATCGTGG
TGCAACTCAATCGGGTTGGCGGCGGCCGCAAGGTGACGGCGGTGGAGTTTCTGTGTTGA
 Primer design