SecReT4
Protein ID: 161504977
T4SS name [ID]Tfc [747]
Gene symbol-
Locus tagSARI_03107
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T4SS(s) in this replicon]
Location [Strand]3027761..3028273 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDA9MS45
KEGG IDses:SARI_03107
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 170 a.a.     [Download]
>gi|161504977|ref|YP_001572089.1| hypothetical protein SARI_03107 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MIVGLLISTHASAVPPLYAQIARQQQIPAELLYAVARAESGTRLAQGLHPWPWTLNIAGTGYRYPSRSSA
CRALLAFARTRSLKRIDAGLGQINLGWNGQWFPSLCASFDPTDNLTVTALLLRQHYNASPGSWLDAAARY
HHPAGGKPAAIYRHKISQQIRLLSASGTSP
 
Nucleotide Sequence: 513 bp     [Download]
>ref|NC_010067.1|:3027761-3028273 hypothetical protein SARI_03107 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGATAGTCGGCCTGCTTATCAGCACTCACGCCAGTGCCGTGCCGCCACTGTATGCGCAAATCGCCCGCC
AGCAGCAGATTCCGGCAGAGCTGCTCTACGCGGTGGCCCGCGCGGAAAGCGGTACTCGACTGGCGCAGGG
GTTACATCCGTGGCCGTGGACGCTGAATATTGCCGGAACCGGCTACCGTTACCCCAGCCGTTCTTCAGCC
TGCCGGGCATTGCTGGCCTTCGCCCGTACCCGCAGCCTGAAACGCATCGACGCAGGGCTGGGACAGATTA
ATCTCGGCTGGAACGGGCAATGGTTCCCCTCGCTGTGCGCCAGTTTTGATCCGACGGACAATCTCACCGT
CACCGCCCTGCTGCTGCGTCAGCACTACAATGCCTCCCCCGGAAGCTGGCTGGACGCTGCCGCCCGCTAC
CACCACCCCGCCGGAGGCAAACCCGCCGCCATCTACCGCCACAAAATCAGCCAGCAAATCCGGCTGCTCT
CCGCATCAGGGACGTCGCCATGA
 Primer design