SecReT4
Protein ID: 161504981
T4SS name [ID]Tfc [747]
Gene symbol-
Locus tagSARI_03111
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T4SS(s) in this replicon]
Location [Strand]3030936..3031616 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDA9MS49
KEGG IDses:SARI_03111
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.7e-45, Aligned region: 43..223
Protein Sequence: 226 a.a.     [Download]
>gi|161504981|ref|YP_001572093.1| hypothetical protein SARI_03111 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MPDHAPQPVRRPGLLGWIALLPGVLVGFCLGAWMLAIALEWLGDAFFWRNTCASHSEQVLQATWQWWRGS
AGAPVWLVENLALISDTLQQGIAALIHSLNGQSGLFWTETVTTVIRCALMSAGNVTLTFLLRLAILLQAL
PLFALTITIGLIDGLVRRDLRRFGAGHESGFVYHHARRMISSCLIATGLMWLAVPIFLVPEYVFIPAAAG
IGLAVSMTGGSFKKYV
 
Nucleotide Sequence: 681 bp     [Download]
>ref|NC_010067.1|:3030936-3031616 hypothetical protein SARI_03111 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGCCCGACCATGCTCCACAACCTGTGCGCCGCCCCGGTCTGCTCGGCTGGATCGCATTGCTGCCCGGCG
TGCTGGTTGGCTTTTGCCTCGGCGCATGGATGCTGGCGATAGCGCTGGAATGGCTGGGCGATGCATTTTT
CTGGCGGAACACCTGCGCCAGCCACAGTGAACAGGTATTGCAGGCGACATGGCAGTGGTGGCGGGGTTCC
GCTGGCGCACCGGTGTGGTTAGTTGAAAATCTAGCGCTTATCAGCGATACATTGCAGCAAGGGATTGCGG
CGCTGATTCATTCGCTCAACGGACAGAGCGGGTTGTTCTGGACGGAAACCGTCACTACTGTGATCCGCTG
TGCGTTAATGTCTGCGGGCAATGTCACCCTCACCTTTCTGCTGCGGCTGGCGATTTTGTTGCAGGCGCTG
CCGCTGTTTGCGCTCACCATTACCATTGGCCTTATCGACGGGCTGGTAAGACGCGACTTACGGCGGTTCG
GCGCAGGCCATGAGTCCGGTTTTGTGTATCACCATGCCAGACGTATGATCTCATCCTGCTTGATAGCAAC
GGGACTAATGTGGCTGGCGGTGCCGATTTTTCTTGTACCAGAGTATGTGTTTATACCAGCGGCAGCAGGG
ATTGGGCTGGCAGTATCCATGACCGGCGGATCTTTCAAAAAATACGTTTGA
 Primer design