SecReT4
Protein ID: 161504985
T4SS name [ID]Tfc [747]
Gene symbol-
Locus tagSARI_03115
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T4SS(s) in this replicon]
Location [Strand]3033731..3034102 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDA9MS53
KEGG IDses:SARI_03115
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 5.4e-28, Aligned region: 37..116
Protein Sequence: 123 a.a.     [Download]
>gi|161504985|ref|YP_001572097.1| hypothetical protein SARI_03115 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MAIAFSANLQVKPILLQATSMLKVLLNIVSLFITSSAFAASLTEREELTLSLNQLTQIEASLHRAQKSAR
TGINERYYFDYPRIHSDITTLRSGIEHYLTPTRAQPRDTPTLVGQYREEKTTP
 
Nucleotide Sequence: 372 bp     [Download]
>ref|NC_010067.1|:3033731-3034102 hypothetical protein SARI_03115 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGCCATCGCATTTAGCGCAAATTTGCAGGTAAAACCCATTCTGTTGCAGGCAACCAGCATGCTTAAAG
TTCTCCTGAACATTGTCAGCCTGTTTATAACCAGTTCCGCTTTCGCCGCCTCCCTCACCGAGCGCGAAGA
GTTAACCCTGTCCCTCAACCAGCTAACTCAAATCGAAGCCTCGCTCCACCGCGCCCAGAAAAGCGCCAGA
ACCGGCATCAACGAGCGTTACTACTTCGACTATCCGCGTATCCATAGCGATATCACCACGCTGCGTAGCG
GGATTGAACATTACCTCACCCCCACCCGCGCCCAGCCGCGAGATACGCCAACGCTGGTCGGGCAATACCG
TGAGGAGAAAACCACGCCATGA
 Primer design