SecReT4
Protein ID: 161504988
T4SS name [ID]Tfc [747]
Gene symbol-
Locus tagSARI_03118
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T4SS(s) in this replicon]
Location [Strand]3034681..3035034 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDA9MS56
KEGG IDses:SARI_03118
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.5e-40, Aligned region: 2..116
Protein Sequence: 117 a.a.     [Download]
>gi|161504988|ref|YP_001572100.1| hypothetical protein SARI_03118 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MSTIPFLPERLNREPAVFRGLTVSELLIALLVGLTAGAVVGVIPAILCRNWSLIPSSALPGGALAILCGG
RWLARLKRGRPESWLYRALELKLARFGIGTQRFVLHDGVWAIRRSRR
 
Nucleotide Sequence: 354 bp     [Download]
>ref|NC_010067.1|:3034681-3035034 hypothetical protein SARI_03118 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGAGCACTATCCCCTTTCTCCCGGAACGGCTGAACCGCGAGCCTGCGGTGTTTCGCGGTCTGACGGTCA
GCGAGCTGCTGATAGCGCTGCTTGTCGGGCTGACCGCTGGCGCAGTCGTTGGAGTCATTCCGGCGATATT
GTGTCGCAACTGGAGTCTTATCCCCAGTAGCGCCCTGCCCGGTGGTGCGCTGGCGATCCTCTGCGGCGGG
CGCTGGCTGGCACGACTAAAACGTGGGCGTCCGGAGAGCTGGCTGTACCGGGCGCTGGAGCTGAAACTGG
CCCGTTTCGGTATCGGCACTCAGCGTTTTGTTCTGCATGATGGCGTCTGGGCCATTCGCCGGAGCCGACG
ATGA
 Primer design