SecReT4
Protein ID: 161505013
T4SS name [ID]Tfc [747]
Gene symbol-
Locus tagSARI_03143
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T4SS(s) in this replicon]
Location [Strand]3060271..3061638 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDA9MER7
KEGG IDses:SARI_03143
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 455 a.a.     [Download]
>gi|161505013|ref|YP_001572125.1| hypothetical protein SARI_03143 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MRSAWCLLFVTFLAPAADKYQYQQQGAISDWMYYRIGGGAAIPPSATRRNTFPLTAGVSWNSDMMCGNFD
IDTTVRNQLNGVTDGFQQLMGEVIESATSAVASLPAMVIQRANPQLYDLLTNGVLQGRLDFDKSLLSCQK
MAGKMTDYALGPAWTQSAQAENYQGIAASEKDAVRADQRAAEEAAEKGKRWVGGEHRGGKGQPPIKLVRD
TTVAGYNILNNRSATSTSSVSSNDCQGELCQVWSKPDDAAQWLTRVVGEQTINVAPDNDQSGDTSQQSGA
QSGVGLTPLIQEEQDKIQPLIIDMVNRSQPVNDDTLAQASGGELHLTRGVIEALRDDPDAAVLIQRLSGE
LALSRVMEQALMARRTLLAGMREPNISGEKEAQTALTQTTAQLDQELSQLKLELDMRQALADNAALTILE
RQTMRAKTKGRAVGVEDDADKRVADLSKPTGGDTQ
 
Nucleotide Sequence: 1368 bp     [Download]
>ref|NC_010067.1|:3060271-3061638 hypothetical protein SARI_03143 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGCGCTCAGCCTGGTGTCTTCTGTTCGTCACCTTTCTCGCTCCGGCGGCTGATAAATACCAGTATCAGC
AACAGGGGGCGATCAGCGACTGGATGTATTACCGCATCGGCGGAGGTGCGGCCATTCCCCCTTCAGCAAC
CCGTCGTAATACCTTCCCACTGACGGCAGGCGTAAGCTGGAACAGCGATATGATGTGCGGCAATTTTGAT
ATCGACACCACAGTCCGCAATCAACTCAACGGCGTGACGGACGGATTCCAGCAACTGATGGGAGAGGTTA
TCGAAAGCGCGACCAGCGCGGTCGCCAGCCTGCCCGCTATGGTGATCCAGCGTGCCAATCCCCAGCTCTA
CGATCTGCTGACCAACGGCGTACTTCAGGGACGGCTCGACTTCGATAAATCACTGCTAAGCTGCCAGAAG
ATGGCAGGCAAGATGACCGATTACGCGCTCGGTCCGGCATGGACGCAGAGCGCTCAGGCGGAAAACTATC
AGGGCATTGCGGCCAGCGAAAAAGACGCCGTTCGCGCCGACCAGCGAGCTGCCGAAGAAGCGGCAGAGAA
AGGCAAACGCTGGGTTGGTGGCGAACATCGCGGCGGCAAAGGCCAACCGCCCATCAAGCTGGTTCGCGAT
ACAACGGTCGCAGGCTACAACATCCTCAACAATCGTAGCGCGACCAGCACCAGTTCGGTATCCAGCAACG
ACTGTCAGGGTGAACTGTGTCAGGTCTGGAGCAAACCCGACGACGCCGCGCAATGGCTGACGCGGGTGGT
TGGCGAGCAGACCATTAACGTCGCCCCGGATAACGATCAATCCGGCGATACGAGTCAGCAAAGCGGCGCA
CAATCCGGCGTTGGGCTGACGCCACTGATTCAGGAAGAGCAGGATAAGATCCAGCCGCTGATTATCGATA
TGGTGAACCGCAGCCAGCCCGTTAATGATGACACATTAGCCCAAGCCAGCGGTGGCGAACTTCATCTGAC
ACGCGGCGTTATCGAGGCGCTGCGCGACGATCCTGATGCAGCAGTACTTATCCAGCGCCTCTCCGGCGAA
CTGGCGCTCTCCCGCGTGATGGAACAGGCGCTGATGGCCCGGCGCACGCTGCTGGCGGGAATGCGCGAAC
CCAATATCTCCGGTGAGAAAGAGGCGCAAACCGCGCTGACTCAGACCACCGCCCAGCTCGACCAGGAACT
GTCGCAGCTCAAGCTGGAATTGGATATGCGCCAGGCGCTGGCAGATAACGCCGCACTCACCATTCTTGAG
CGCCAGACAATGCGGGCGAAGACCAAAGGCCGAGCTGTCGGCGTGGAGGACGACGCCGACAAACGGGTGG
CCGATCTCAGCAAACCCACTGGCGGGGATACGCAATGA
 Primer design