SecReT4
Protein ID: 161506536
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6204
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]53708..56971 [+]
Productconjugative relaxase domain-containing protein
Component typeTraI_F
UniProt IDA9ATZ1
KEGG IDbmu:Bmul_6204
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 6.3e-54, Aligned region: 3..236
AAA_30 [PF13604], Evalue: 3e-34, Aligned region: 407..489
AAA_30 [PF13604], Evalue: 3e-34, Aligned region: 639..752
AAA_19 [PF13245], Evalue: 3.8e-05, Aligned region: 415..472
Protein Sequence: 1087 a.a.     [Download]
>gi|161506536|ref|YP_001573657.1| conjugative relaxase domain-containing protein [Burkholderia multivorans ATCC 17616]
MPHPDTGKIQNLANNSKGDKRRAGIDFTIAPPKSVSIAALVGKDDRVIAAHLAANARTMEWFEKHASLIR
VKDEKGRNRPEVAGNLLYATVLHETNRENEPQLHNHNVIVSAVYDGARHSWRSLTNDLLYTLRARGDIIY
KAELAAALRHLGYQLVYAENGIDFELKGFSRDHVDTFSTRAVQVREALLKHGIDPGEASFDARRVAKLDS
RAAKQEHPREILQSVWEETAKEANLDVASIVERAREAFADRQVPRRGVERTVEHGAAMGQDSGPSRGAAV
SVSNDARANALRAVSWAIEHLTEREQAFTLVDLEVTALKFSRGSISEIEWAIDQHVRNHMLVDRGITVGG
QIQYTTHKAIDNELKLAEHILAGRGQGNVVLDAEDQFDAAVAAFEAKKTAEIGEQFKLSGEQIQAARNVL
MHEDSIQGIQGEAGTGKTAALAMVKDVAQAMGWEVIGVATSAAAAKELEASSGIQSDTVAGYFAKRDSAI
RAVELRLQDLRKSISERATLRGLDDQRIEARTLAVKSEDIDYGTHRYTFDHQRGEVFRSPENLRNAIGAA
LSEIAARHREAAGTEQGHPVTLGEQARETVRAAAANVAASLGRRLMTFEQIGTAEAVAARNTLYLERQGS
ATELDAEYARTQAKLENLRRYGNVDGKKTLIVMDESSLTGVDDTEKLLRFAREIGARTVLQGDVKQHGSV
AAGRAFEQAQIAGMNVSILEETRRFRDATAQTRQALADMKAGNYAQAIARLDTLRVAESDLAKTVAERYL
ENLQELTAKGVDAPKVGVVAITNSDRKLINAAVHQALTDVGIISGPHFEKPHLDDPKMTGAEQRYASMLS
RNRVDALIYRKSYREIGVEKGDVLTVTGYDVQKNRIYALNAKGKSVEINPQRQDYFSPAIQESRVFAVGD
RVETRAIIRLPGQELNRLDNGTQGVIVAIDSLGAKIRWYRDGKESDLKNDDLRFVDHAYAHTSYKEQGAT
NHREIVAVSKIGARVFNREAAYVAASRAKDNTEIITSDLDTLLRNAGREVGKTTAVEFERAESSLDQSAD
QGAKHGATRSIEVAPTRSVETERTLERSPDPGNLLGF
 
Nucleotide Sequence: 3264 bp     [Download]
>gi|161506495|ref|NC_010070.1|:53708-56971 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
ATGCCGCATCCGGACACTGGCAAGATCCAGAATCTGGCGAACAACAGTAAGGGGGACAAGCGCCGGGCGG
GTATCGACTTCACGATTGCGCCGCCGAAAAGCGTGTCGATCGCGGCATTGGTTGGGAAGGACGACCGTGT
GATCGCGGCGCACCTTGCAGCGAATGCGCGGACGATGGAATGGTTTGAGAAGCATGCTTCTCTGATTCGC
GTGAAAGACGAAAAGGGAAGAAACCGGCCGGAAGTGGCCGGCAACTTGCTGTATGCGACGGTGCTGCACG
AAACTAACCGGGAGAACGAGCCGCAGCTTCATAACCACAACGTGATCGTATCCGCTGTTTACGATGGGGC
ACGCCATTCGTGGCGCAGCCTTACCAACGACCTGTTGTACACGCTACGGGCGCGCGGCGACATCATTTAC
AAAGCGGAGCTCGCGGCTGCCCTGCGACATCTTGGTTACCAACTTGTGTATGCGGAGAACGGCATCGATT
TCGAGCTGAAGGGCTTTTCACGCGATCACGTCGACACATTCAGTACCCGCGCGGTCCAGGTCCGCGAGGC
GCTTTTGAAGCATGGCATAGATCCGGGCGAAGCTAGCTTTGATGCACGCAGGGTAGCCAAACTCGACAGC
CGAGCAGCCAAGCAGGAGCACCCCCGGGAGATTCTGCAGTCGGTGTGGGAGGAGACGGCGAAAGAAGCAA
ATTTGGACGTGGCCTCGATCGTAGAACGCGCGCGGGAGGCGTTCGCTGATCGGCAAGTTCCGCGACGCGG
TGTAGAGCGAACGGTGGAGCACGGGGCGGCGATGGGGCAGGATTCCGGGCCAAGTCGGGGCGCAGCAGTT
AGCGTTTCGAACGATGCTCGAGCGAACGCTCTGCGGGCAGTCTCCTGGGCGATCGAACATTTGACCGAAC
GGGAGCAGGCTTTCACACTCGTTGATCTCGAGGTCACGGCGTTGAAGTTCAGTCGCGGCAGCATTTCTGA
GATCGAGTGGGCGATCGATCAGCATGTGCGTAACCATATGCTGGTCGATCGCGGCATCACGGTGGGCGGC
CAGATCCAATACACGACCCACAAGGCGATCGATAACGAGCTTAAGCTTGCGGAGCACATTCTCGCCGGCC
GAGGTCAGGGAAACGTTGTGCTCGATGCGGAAGACCAATTCGACGCCGCGGTCGCGGCATTCGAAGCGAA
GAAGACAGCCGAAATTGGAGAGCAGTTTAAGCTCTCCGGGGAACAGATACAGGCGGCTCGCAATGTCCTG
ATGCATGAAGATTCGATTCAGGGCATTCAGGGCGAGGCCGGGACAGGCAAGACGGCGGCGTTAGCGATGG
TGAAGGACGTCGCTCAAGCGATGGGGTGGGAGGTAATTGGCGTGGCGACCTCCGCAGCGGCCGCGAAGGA
GCTCGAGGCTTCGAGCGGCATCCAAAGCGATACCGTTGCAGGGTATTTCGCGAAACGAGACAGTGCCATC
CGGGCGGTCGAGCTTCGGCTTCAAGACCTACGGAAGTCGATCTCGGAACGGGCGACGCTCCGGGGCCTCG
ACGATCAGCGAATCGAGGCTCGGACGTTGGCGGTAAAGAGCGAAGATATTGACTACGGCACCCACAGGTA
CACGTTTGATCATCAGCGGGGTGAAGTCTTCCGGTCGCCGGAGAACCTTCGCAATGCGATCGGGGCAGCG
TTATCGGAAATCGCGGCGCGTCACAGAGAAGCGGCCGGAACTGAACAGGGACACCCTGTAACGCTCGGCG
AACAGGCTAGGGAGACGGTGCGTGCTGCAGCGGCTAACGTTGCGGCGTCCCTCGGCCGTCGACTCATGAC
ATTCGAACAGATCGGAACAGCAGAGGCTGTCGCGGCGCGGAACACGCTTTACCTTGAGCGGCAAGGGTCC
GCAACGGAACTCGATGCGGAATACGCTCGGACGCAGGCAAAGCTCGAAAACCTTCGGCGGTACGGGAACG
TTGACGGAAAGAAGACTCTGATCGTGATGGATGAATCGTCCTTGACCGGCGTGGACGACACGGAGAAACT
CCTACGATTCGCGCGCGAAATCGGCGCGCGGACCGTCCTGCAAGGCGACGTGAAGCAGCACGGCAGTGTT
GCAGCCGGTCGGGCGTTCGAACAAGCGCAGATCGCAGGGATGAACGTGTCAATTCTCGAGGAGACGCGGC
GTTTTCGGGACGCTACCGCGCAAACACGCCAAGCCCTCGCGGACATGAAGGCGGGGAACTACGCACAGGC
GATCGCGCGTCTCGACACCCTGCGTGTAGCGGAATCAGACCTTGCAAAAACTGTAGCGGAGAGGTACCTG
GAGAACCTCCAGGAATTGACGGCAAAGGGTGTCGATGCGCCGAAGGTCGGTGTGGTCGCGATCACCAACA
GCGACCGGAAATTGATAAACGCCGCTGTTCATCAGGCTTTGACCGATGTAGGGATCATCAGCGGCCCGCA
CTTCGAAAAGCCACACCTTGACGACCCGAAGATGACCGGCGCCGAGCAACGCTACGCATCAATGCTGTCT
CGAAATCGGGTAGATGCGCTCATCTATCGAAAGAGCTACCGCGAAATCGGCGTTGAAAAAGGCGACGTGC
TCACAGTGACTGGGTATGACGTCCAGAAGAACCGGATCTATGCGCTGAATGCCAAAGGAAAGTCGGTGGA
GATTAACCCTCAACGCCAAGACTACTTTTCCCCGGCGATTCAAGAGTCGCGCGTTTTCGCCGTAGGTGAC
CGAGTCGAAACCAGGGCGATCATACGCCTTCCAGGTCAGGAGTTGAATCGGCTAGACAATGGCACGCAAG
GCGTTATTGTCGCGATCGACAGCCTTGGTGCCAAGATTCGATGGTATCGAGATGGAAAGGAGTCGGACCT
AAAGAACGACGACCTGCGGTTTGTGGATCATGCGTACGCTCACACGTCGTACAAGGAGCAAGGGGCCACG
AACCACCGGGAAATTGTGGCGGTCAGCAAGATCGGTGCGCGCGTGTTCAATCGTGAGGCCGCGTATGTTG
CTGCGTCGCGAGCGAAAGACAACACCGAGATCATCACCTCGGATTTGGATACGCTACTTCGCAACGCCGG
TAGGGAAGTGGGCAAGACAACAGCAGTCGAGTTTGAACGGGCTGAGTCTTCCCTTGATCAGAGTGCTGAC
CAAGGGGCGAAGCACGGTGCTACTCGGAGTATTGAGGTAGCACCGACTCGTTCGGTGGAAACCGAGCGAA
CCTTGGAGCGTTCACCCGACCCTGGAAACTTGTTAGGCTTTTAA
 Primer design