SecReT4
Protein ID: 161506546
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6214
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]72065..73522 [-]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDA9AU01
KEGG IDbmu:Bmul_6214
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.9e-28, Aligned region: 86..228
TraN [PF06986], Evalue: 3.9e-28, Aligned region: 353..419
Protein Sequence: 485 a.a.     [Download]
>gi|161506546|ref|YP_001573667.1| conjugal transfer mating pair stabilization protein TraN [Burkholderia multivorans ATCC 17616]
MSRAPASLCLPRRTEEPPMLITRIRRLFTSLVVTVLSLPLPTTAQTYGPGACSPVPGSQTCIDTTPCKTS
GTGQQICLSTATPPAGALQVPYSCWQYSYSYACTGTTVDTCGQYRSNSACGVVGSVCNDTIAETGQCDEW
TYTYRCQTKAEQTGQQMNCSNGLFDNSGFPTPPNNNNSFLTGAIGLELLGEAQKYTDGNSIFAGVEESCR
KGYEGIQNCCKSTPGAQSNNMVMTAAIGAAGSVAKYAGEKLIDLASPYVFDAMYTNGIFSEALTQNFTTA
FSLDAANGGGTLGTQLASGGIQFGVYGFTVGFGTMTPGLFGANMQLASFGSNGYLAFNPYVFAAMVAIQV
IQGLSKCSQGEQLLALHKGAGLSTFIKEECAKKALGACVQYVDTYCSFNSQLAQIINIQGKTQLGLPLEG
CSGLTPDQISKIDFKKIDFSAFSSQMMDQAMKGLPKNITGNYTPIMQNTPSGSSQKGGSAVLPTY
 
Nucleotide Sequence: 1458 bp     [Download]
>gi|161506495|ref|NC_010070.1|:c73522-72065 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
ATGAGCAGAGCGCCGGCGTCGCTCTGCCTACCCCGGCGAACTGAGGAACCACCGATGCTGATTACCCGTA
TTCGACGCCTCTTCACTTCGCTGGTCGTCACGGTGCTTTCCCTTCCCCTGCCGACAACGGCACAAACCTA
TGGCCCCGGCGCATGTTCCCCCGTCCCAGGGTCGCAGACTTGCATCGACACGACGCCGTGCAAAACGTCA
GGCACTGGTCAGCAAATTTGCCTTTCCACTGCGACGCCGCCCGCAGGCGCACTGCAGGTCCCTTATAGCT
GCTGGCAGTACTCCTACAGTTACGCTTGCACCGGCACCACCGTCGACACCTGCGGTCAGTACCGCAGCAA
CTCAGCCTGCGGCGTGGTCGGTAGCGTTTGCAATGATACGATCGCCGAAACTGGGCAGTGCGACGAATGG
ACGTATACCTACCGTTGTCAAACCAAGGCCGAGCAGACTGGCCAACAGATGAATTGCTCGAACGGTCTGT
TTGACAACAGCGGCTTTCCGACGCCGCCGAACAACAACAACTCGTTCCTGACGGGAGCAATCGGGCTCGA
ACTGCTCGGTGAGGCACAGAAGTACACCGACGGCAATAGCATCTTCGCCGGGGTCGAGGAAAGCTGCAGA
AAGGGTTACGAAGGAATCCAGAATTGCTGCAAGAGTACCCCTGGCGCGCAATCGAACAACATGGTAATGA
CAGCGGCCATCGGCGCAGCTGGTTCGGTCGCCAAGTATGCCGGCGAGAAGCTGATTGATCTCGCGTCGCC
ATACGTGTTCGACGCGATGTATACGAACGGAATTTTCTCCGAGGCGCTGACGCAGAACTTCACGACAGCA
TTCTCTCTTGATGCGGCCAATGGCGGCGGAACACTCGGTACTCAACTCGCTTCTGGCGGCATACAGTTCG
GCGTATATGGTTTCACGGTCGGGTTCGGAACGATGACCCCAGGGCTTTTCGGCGCGAACATGCAACTGGC
TTCCTTCGGCTCCAACGGATACCTCGCGTTTAACCCATATGTCTTCGCTGCGATGGTTGCAATTCAGGTC
ATCCAAGGCCTATCGAAGTGCTCGCAGGGCGAGCAGCTCCTGGCGCTTCATAAGGGTGCCGGTCTAAGCA
CGTTCATCAAAGAGGAGTGTGCCAAGAAGGCGCTGGGTGCCTGCGTTCAATACGTCGACACCTATTGTTC
CTTCAACTCGCAACTCGCTCAGATCATCAACATTCAAGGGAAGACGCAACTGGGCCTTCCGCTTGAGGGT
TGCAGTGGCCTGACTCCGGACCAGATCAGCAAGATCGATTTCAAGAAGATTGACTTCAGTGCATTCTCGA
GCCAGATGATGGATCAAGCTATGAAAGGCCTCCCGAAAAATATCACCGGGAATTACACACCGATCATGCA
GAACACTCCGAGCGGATCTTCCCAAAAGGGCGGCTCTGCCGTTCTTCCGACTTACTGA
 Primer design