SecReT4
Protein ID: 161506552
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6220
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]79972..83394 [-]
Producthypothetical protein
Component typeTraG_F
UniProt IDA9AU07
KEGG IDbmj:BMULJ_06200, bmu:Bmul_6220
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 5.3e-13, Aligned region: 34..501
Protein Sequence: 1140 a.a.     [Download]
>gi|161506552|ref|YP_001573673.1| hypothetical protein Bmul_6220 [Burkholderia multivorans ATCC 17616]
MAIPTLTIYSATADPTTLRAILDSVAMVCKNNLMVWGFAVMVALWRLSASTAAAALRSASGQGGAVLGNG
ALSAAMPFILATVLTNPMLKSTVQIESTVNGSLTEVDNVPLAISIIPVAGSVLSMDLNDTVSTAFQRASA
EYPTISASANGFLNPLKALLSARTATSRLSGIDSEVKTVLASCLGPDSGVNYSNIQRLVMNAGNTGATSA
QSIPVNGINPTAIGALLYQASLNSTGKVNDIGLDSTNILSCSDAAYRVADDITNALNSLEFPRVVQGAVN
GLDSPRPGADYSFNSLASQYYAVSRANTLGGVFAGGTGQANAEFMNLLFSEMVQGDLSCLRAGGDTLIQC
QASVLQAAEVERNNLQAAASEIPAMRYAGAFGNYLIAVIIGLGPVIIMFMMFAGIEAGKSVKTAAHIIVW
PLLVNNVGAEIVNGIISIDIANYLQALRQGGWLSQATTYTAYKELSLQIGVGSHIMSSLPVLMSIIFGLG
ESSAMTTVATNIAPRSKETTDNVAPAPQATRPMFEGGPVGTISQMGHGAGKLSMTGSVDAVSTSMNFGNM
ARDASRSLTQSEVRSHNLSAGESNLAEFRRAFSTGDFSRLNIDRQVGQTLAENFNNEIRSGKEQHAGNAV
TGTRSNSNRTTIGAGGSVSASLKSGFSAGLGAHADTSTSADDALQRNDNRGQSDNYSDSVALSRALAKTM
AQYSNTSAGSQSTSELSRALSTQRSYQQTLSEVQSVSDAATQGVRESSGFVSMSGKIGSEEIAWQQRANP
EYAAFQMTQGRRFEENGATRPYLQTAAADAASGATGRLVGDRAGQAAINRHRAAVMLAQDQNARPEDRIA
AARYLADEARAMQHMKFDPTNPAPMNLEIGSPRDGTGVSSSEIAPFARRHLPPPTAPAARIASTTSASPG
DDGAHEGAIHPRGGRVGTVPAYRGPGASNPVAESQLPQANTSARAVQPGSNDHHAVRAEMPLSRARESKD
LGGVTGRRSTAADTGAAVASGRQPSGTAADHSTSAPQIPPHTPNGPVHSPRVAPPPVPEQLPAFGGDFER
QMRDELASRRDRVSASVQSGDTQAANAGLDAKGHGTAIRAAANVVDNVADIGRTAGAGSRTGLAPPVNPQ
KGRPSTPSANPDLTPGKRGN
 
Nucleotide Sequence: 3423 bp     [Download]
>gi|161506495|ref|NC_010070.1|:c83394-79972 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
ATGGCTATTCCAACTCTCACAATCTATTCCGCGACTGCGGACCCAACCACCCTGCGTGCCATCCTGGACA
GCGTCGCAATGGTATGCAAGAACAACCTAATGGTTTGGGGTTTTGCCGTGATGGTGGCGCTATGGCGCCT
GAGCGCGTCGACCGCTGCTGCCGCGCTGCGGTCGGCATCGGGACAGGGAGGGGCAGTTCTTGGAAATGGT
GCGTTGAGCGCGGCGATGCCCTTTATCCTGGCCACGGTGCTTACAAACCCGATGTTGAAAAGCACGGTTC
AGATCGAGTCAACGGTCAACGGGAGCCTTACTGAAGTCGACAATGTGCCGCTTGCGATCTCGATCATCCC
GGTCGCTGGCAGCGTTCTATCAATGGACCTGAACGACACCGTTTCGACAGCGTTCCAGCGTGCGAGCGCG
GAGTATCCGACGATCTCCGCCAGTGCCAACGGCTTTCTCAATCCTCTAAAAGCGCTTCTCAGCGCCCGTA
CGGCGACATCGCGACTTAGCGGGATTGACTCCGAGGTGAAAACCGTTCTCGCGTCATGCCTCGGCCCTGA
TTCTGGTGTCAACTACTCGAACATTCAACGCCTCGTCATGAACGCGGGAAACACGGGGGCAACCAGCGCA
CAGTCGATCCCCGTCAATGGGATAAATCCGACAGCGATCGGCGCGCTTCTTTACCAGGCTTCGCTGAACA
GTACAGGAAAGGTCAACGACATCGGCCTAGATTCGACCAACATTTTGTCATGCTCTGACGCAGCGTATCG
CGTGGCGGACGACATCACGAACGCTCTGAATTCGCTCGAGTTCCCACGTGTCGTTCAAGGGGCGGTGAAC
GGCCTCGACTCACCGCGTCCAGGCGCGGACTACAGTTTTAACTCGCTTGCCTCGCAGTACTACGCAGTTT
CCCGGGCGAATACTCTTGGCGGTGTGTTCGCCGGCGGGACCGGTCAGGCGAATGCAGAGTTCATGAATCT
ACTGTTTTCCGAGATGGTTCAAGGGGATTTAAGTTGCCTTCGTGCAGGCGGCGACACCTTAATTCAGTGC
CAAGCTTCGGTACTACAAGCGGCTGAGGTCGAGCGCAATAACCTTCAAGCGGCGGCCAGCGAGATTCCTG
CCATGCGGTACGCCGGCGCCTTTGGTAACTACCTCATCGCGGTCATCATCGGCCTCGGGCCCGTCATCAT
CATGTTCATGATGTTCGCTGGTATCGAGGCCGGCAAGTCGGTGAAGACGGCCGCACACATCATCGTGTGG
CCGCTGTTGGTCAATAACGTCGGCGCCGAGATCGTCAACGGGATTATTTCGATCGACATCGCGAACTATC
TCCAGGCACTGCGCCAAGGTGGGTGGCTTTCACAGGCCACTACGTACACCGCATACAAGGAGCTGAGCCT
GCAGATTGGCGTCGGCTCTCACATCATGTCGAGTCTGCCGGTCTTGATGAGCATCATCTTCGGCCTGGGC
GAATCGTCGGCTATGACAACCGTCGCCACTAACATCGCACCACGATCCAAGGAAACGACTGACAACGTCG
CGCCGGCGCCGCAAGCGACCCGCCCGATGTTCGAGGGCGGCCCGGTAGGAACAATCAGCCAGATGGGACA
TGGTGCGGGCAAGCTTTCGATGACTGGTAGCGTCGACGCGGTCTCGACGAGCATGAACTTCGGGAACATG
GCACGCGACGCGAGCCGATCGCTCACACAGTCGGAGGTACGCAGCCACAATCTCAGCGCAGGAGAGTCCA
ACCTCGCCGAATTTCGCCGCGCGTTCTCGACGGGCGATTTCAGCCGTCTCAACATTGACCGTCAGGTTGG
GCAAACGCTCGCGGAGAACTTTAACAACGAGATTCGAAGCGGCAAAGAGCAACATGCCGGAAACGCGGTG
ACCGGTACACGCAGCAACTCAAATCGAACGACTATCGGAGCGGGCGGCAGCGTGAGCGCGAGCCTGAAGA
GCGGCTTTAGCGCCGGTCTCGGGGCACATGCCGACACAAGCACTTCAGCGGACGACGCGCTGCAACGCAA
CGATAACCGTGGCCAGTCGGACAACTATTCCGACTCGGTAGCGCTTAGCAGGGCACTGGCAAAGACTATG
GCTCAGTATTCCAATACCAGCGCCGGTAGTCAGTCGACGTCTGAGCTGTCTCGCGCGCTGTCGACACAGC
GCAGCTATCAGCAAACTCTGTCGGAAGTTCAATCCGTGAGCGACGCGGCAACACAAGGTGTCCGGGAGAG
CTCGGGCTTCGTTAGCATGAGCGGAAAAATCGGCTCTGAGGAAATCGCGTGGCAACAGCGAGCGAACCCC
GAATATGCCGCTTTCCAGATGACTCAAGGGCGCCGCTTCGAAGAGAATGGCGCGACGAGGCCGTACCTCC
AAACTGCTGCGGCAGACGCGGCGTCCGGCGCGACGGGCCGTCTCGTCGGCGATCGAGCCGGGCAAGCGGC
GATTAATCGGCATCGGGCAGCAGTGATGCTCGCGCAAGACCAGAACGCCCGTCCCGAAGATCGAATCGCG
GCCGCGCGCTATCTGGCTGATGAAGCTCGAGCTATGCAGCATATGAAGTTCGATCCAACGAATCCTGCAC
CGATGAACCTCGAAATTGGATCGCCGCGTGATGGCACTGGCGTTAGCAGTAGCGAGATCGCACCCTTTGC
GCGTCGCCATTTGCCGCCGCCCACAGCACCGGCAGCGCGAATCGCGTCCACCACTTCCGCGTCGCCCGGC
GACGACGGCGCCCATGAGGGGGCCATTCATCCTCGTGGTGGCCGCGTTGGAACCGTGCCGGCCTATCGGG
GGCCCGGCGCTTCCAACCCGGTCGCGGAATCCCAACTGCCGCAAGCAAACACGTCCGCGCGGGCTGTTCA
ACCAGGTTCGAACGACCATCACGCAGTACGGGCCGAAATGCCACTATCTCGGGCGCGCGAGTCCAAAGAT
CTCGGCGGTGTCACTGGCCGCCGGTCGACTGCCGCCGACACCGGCGCTGCCGTCGCTTCCGGTCGCCAGC
CGTCCGGTACCGCGGCCGACCACTCCACCTCCGCGCCACAGATACCCCCCCATACTCCCAACGGGCCCGT
TCATTCGCCACGGGTCGCTCCGCCTCCAGTCCCCGAACAACTGCCGGCATTTGGCGGCGATTTCGAACGA
CAGATGCGCGACGAACTGGCTAGCCGAAGGGATCGAGTTAGCGCTTCGGTCCAGTCTGGCGACACTCAGG
CGGCCAACGCCGGGCTCGACGCGAAGGGGCATGGCACGGCGATTCGCGCGGCCGCGAACGTCGTGGACAA
TGTCGCGGACATCGGTCGCACGGCTGGCGCCGGCTCCAGAACCGGTCTGGCTCCGCCGGTAAATCCCCAA
AAGGGTCGACCGTCAACTCCGAGCGCTAACCCGGATTTAACGCCTGGAAAAAGAGGGAATTGA
 Primer design