SecReT4
Protein ID: 161506553
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6221
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]83408..84889 [-]
ProductTraH family protein
Component typeTraH_F
UniProt IDA9AU08
KEGG IDbmj:BMULJ_06199, bmu:Bmul_6221
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.5e-56, Aligned region: 28..426
Protein Sequence: 493 a.a.     [Download]
>gi|161506553|ref|YP_001573674.1| TraH family protein [Burkholderia multivorans ATCC 17616]
MRVKKFLLIVAMVVVPHLAFAGILADLGSMVMANSTAPGAMTTKDRVGVFMGAFTMRSPIKAVNLVTFDP
PRIDAGCGGIDLYGGSFSFINSQQLIQIFRQVAADAAGLAFKAAIKSISPSLDALITEFQTLLQNLNNLA
KNSCQMAHLIVDPIDNALSNAVNGDGNTGGTNSNMFTDVMGGLKSYLSDANSYFKNQSANNPKSGNPLVK
KVVASGASSIMGLAGLPNVDGSSDNPSDPNSLNNMVLYALLGYNIDAAPCNSLNQAGQGIQSSRPANNTI
GQVTCSGPAVMTLDDLVKGGGTGSLRPDVPLQLYRCANPNGSVFGGVDNQICTQMQVISFNYVGIEGWVN
SMLFGSVDPALSVAGNSIVGQINSVNSTTFSAQQVAFMKQAGVPLAGLLSKTSNTATRVAIAQRLAPHIV
DCVAARIGEVLYKGANLIQTTPGYDLTDDQKDRIKTLRTDYLAKQNACNNSDALLRIITEINEGTRFVNT
NIK
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|161506495|ref|NC_010070.1|:c84889-83408 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
GTGCGCGTGAAAAAATTTCTGTTGATTGTGGCGATGGTCGTCGTGCCGCATCTCGCATTCGCCGGCATTC
TGGCTGACCTCGGTTCTATGGTGATGGCGAACAGTACCGCGCCAGGAGCCATGACCACGAAGGATCGTGT
TGGCGTCTTTATGGGCGCATTCACGATGCGTTCGCCGATCAAAGCAGTCAATCTCGTCACATTCGATCCT
CCGCGAATCGACGCCGGCTGCGGCGGTATCGACCTCTACGGTGGATCCTTCAGTTTCATCAACAGTCAGC
AGCTAATTCAGATTTTCCGGCAGGTAGCCGCCGACGCGGCCGGGCTCGCGTTCAAAGCGGCGATCAAGTC
AATCTCCCCCTCGCTCGACGCGTTGATCACCGAGTTTCAGACGCTGCTGCAAAATCTGAACAACCTTGCG
AAGAACTCCTGCCAGATGGCGCACCTCATTGTTGATCCGATCGACAACGCTCTTTCCAACGCGGTGAACG
GCGATGGCAATACAGGTGGAACCAACTCGAATATGTTCACAGATGTGATGGGCGGTCTCAAGAGCTACCT
CTCCGACGCCAACTCGTACTTCAAGAATCAGTCTGCGAACAATCCGAAGAGCGGGAACCCTCTGGTGAAG
AAGGTAGTCGCGTCCGGCGCGTCGTCGATCATGGGACTCGCCGGCTTACCGAACGTCGACGGGAGCAGCG
ATAACCCATCCGATCCGAACAGTCTGAACAACATGGTGCTTTACGCACTGCTTGGCTACAACATCGATGC
CGCGCCGTGTAACAGCCTTAATCAGGCGGGGCAGGGCATCCAGTCGTCACGTCCCGCCAACAACACCATT
GGCCAAGTGACGTGTTCGGGGCCGGCCGTGATGACCCTCGACGACTTGGTGAAGGGTGGCGGAACCGGGT
CGCTTCGCCCCGATGTACCTCTGCAGCTTTATCGCTGCGCGAACCCCAACGGGAGTGTTTTTGGGGGCGT
TGATAACCAAATCTGTACGCAGATGCAGGTCATCTCCTTCAATTACGTTGGCATCGAGGGATGGGTTAAC
TCAATGCTGTTCGGCTCGGTTGACCCGGCGCTCTCCGTGGCGGGAAACTCGATCGTCGGTCAAATCAATA
GCGTGAATTCGACCACCTTCTCCGCTCAGCAGGTCGCCTTCATGAAGCAAGCAGGCGTTCCGCTCGCGGG
GCTCCTATCCAAGACGTCGAACACCGCGACCCGCGTCGCTATCGCGCAGCGGCTGGCTCCCCATATCGTC
GACTGCGTGGCGGCTCGAATCGGTGAGGTCCTCTACAAGGGCGCAAACCTCATCCAAACGACACCTGGGT
ATGACCTCACCGACGATCAGAAGGACCGTATCAAGACGCTTCGAACCGACTATCTCGCCAAGCAGAACGC
CTGCAATAACAGCGATGCACTTCTCCGGATCATCACTGAGATCAACGAAGGGACGCGCTTCGTGAATACC
AACATCAAGTAA
 Primer design