SecReT4
Protein ID: 161506554
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6222
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]84900..85916 [-]
Productsex pilus assembly protein
Component typeTraF_F
UniProt IDA9AU09
KEGG IDbmj:BMULJ_06198, bmu:Bmul_6222
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.7e-58, Aligned region: 47..280
Protein Sequence: 338 a.a.     [Download]
>gi|161506554|ref|YP_001573675.1| sex pilus assembly protein [Burkholderia multivorans ATCC 17616]
MHTACFDIARGRRIAQWIALALLPVSIHVVAAPATDSPRGDAYGDAFLNYQPYVTPAAPVQASAPASKPP
TQTAPAPATVAETGPQKVDVVFLRKVYPVLEERAINDPTDANISAYMYTKRIILDKAQRFSQSVARVLRQ
DPLLDENNRVPYASTGALSVRNADYQAQQKAVEELARIGGLVAFVDSTCRFCAMQIPVLDMLKRAHKIEY
LVVSLDGARPKGFNGPLISDNGLFRKLGLKLTPSIVFVPRPRAYVGADDPNRYLVVSQGFYAMDELVKQI
AYAGHDTKLLSAEVMRDLNVWDRGVTTTQDLNKLRLDPNKPGSFREILQPYLLKQYQN
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|161506495|ref|NC_010070.1|:c85916-84900 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
ATGCATACCGCCTGTTTTGACATCGCGCGCGGTCGGCGCATTGCCCAATGGATCGCGCTCGCCCTGCTGC
CAGTCTCGATCCACGTCGTCGCGGCGCCAGCGACTGACTCGCCACGGGGTGACGCATACGGCGATGCTTT
CCTCAACTATCAGCCTTACGTCACACCAGCTGCGCCCGTCCAAGCCTCCGCACCCGCGTCTAAGCCGCCC
ACACAAACGGCGCCAGCGCCAGCTACAGTAGCCGAGACGGGCCCCCAAAAAGTCGACGTAGTCTTTCTTC
GAAAGGTTTACCCGGTGCTAGAAGAGCGGGCGATCAATGACCCCACCGACGCCAATATCTCGGCGTACAT
GTATACGAAGCGCATTATTCTCGACAAGGCTCAACGATTCTCTCAGAGCGTTGCGCGTGTGCTTAGGCAG
GACCCGTTACTCGACGAAAACAACCGGGTTCCGTATGCCTCGACCGGAGCGCTATCTGTACGCAACGCCG
ACTATCAAGCTCAACAAAAGGCCGTGGAAGAGCTCGCCCGCATCGGCGGGCTTGTCGCCTTCGTCGACAG
TACATGCCGGTTCTGCGCAATGCAGATCCCTGTCCTCGACATGCTCAAACGCGCGCACAAGATCGAGTAT
CTGGTGGTGTCGCTTGACGGTGCTCGCCCTAAGGGATTTAACGGCCCGCTCATCTCAGATAACGGTCTGT
TTCGAAAACTCGGGCTGAAACTAACGCCCTCCATCGTCTTCGTTCCCCGGCCTCGCGCATATGTCGGGGC
CGACGATCCTAACCGTTATCTGGTGGTGTCCCAAGGGTTCTATGCGATGGACGAACTCGTTAAACAGATC
GCGTACGCTGGTCACGATACGAAGCTGTTAAGCGCGGAGGTAATGCGCGATCTCAACGTCTGGGACCGTG
GCGTAACGACTACACAGGACCTCAACAAGCTGAGGCTCGATCCGAACAAGCCAGGCTCGTTCCGCGAGAT
CCTTCAGCCGTACCTCTTGAAGCAATACCAGAACTAA
 Primer design