SecReT4
Protein ID: 161506556
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6224
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]86855..89437 [-]
ProductType IV secretory pathway VirB4 protein-like protein
Component typeTraC_F
UniProt IDA9AU11
KEGG IDbmj:BMULJ_06196, bmu:Bmul_6224
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.8e-41, Aligned region: 449..739
TraC_F_IV [PF11130], Evalue: 4e-36, Aligned region: 11..241
Protein Sequence: 860 a.a.     [Download]
>gi|161506556|ref|YP_001573677.1| Type IV secretory pathway VirB4 protein-like protein [Burkholderia multivorans ATCC 17616]
MTATTLKVRRSPASDILNIETYTSDSNLVISKAPGAERPLIGAVYRMSPLAGGGGEFSTVVQNVFKAVPD
QSVIQVTLVIHPDHDAPDTYLKGKLYGGPVVQDLIKRQADLYRRGLASGELPDLPGINKRTVYVSLAVPH
RKADDEAVEKSASLQQEFFTNMRGCGFHDVVQLNINQLVGVYRQITNIYEPATVPELDPTLDLRYQVFGP
DQTFDFRDPHVGEINGNTYCTTVTVKKYPERPFHGIMNLLSGAPFNSGSVREGGGQRIEGPCIITTTVRV
ANQRREWTRVESAIRSRRQHQPLPIKLGVEDTPRVLADLEEIKRQCAEDGTKFVYVSTNAFLFGRDRDEA
VRAGASVKGTLDKLGFDGRDVVATGLVRLAQTLPLNFSNTIADDLAGEATMASSEVGCLLPVYGDYLGNV
NSDFPLTGMAYPTRRGTMHYFDPYVSNSNFNGVMAAESGVGKSFSLQAKITAELAEGDNIVLFDNGRSSL
KFCALIGGEYNEFGGAKAWRPSLQPFSNLTDEEFDEQQETITSLHMLMAYDEEKPDPGARIALSEAVKAA
WGQRGKDAEVSTTIACLQAIVESAAENQIQNQVHVAAANLIPRLKAFVDSPTRGPYFRGPSTLDPKAQFT
VFELAGLGDDNHLKRVVLFCCVNILLSRIKKFKGRKRIYVDEAQDLFSIDSAADAFEGLYLKGRKNGVSV
WVIVQSLLKLASFKAGSVILRQSAWKMIMAQKKDEIDAVIDQKVMTAFADDPYFQKLIKSVESKKNFWSE
ILIMSDKTYEVVRLYVDKFTATLFSSEGAARDDVLQMMEEGVGPLEAVRKVMGDKKARRREWMSEFLDMC
KNIDGLTFNEIVRELKEIAK
 
Nucleotide Sequence: 2583 bp     [Download]
>gi|161506495|ref|NC_010070.1|:c89437-86855 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
TTGACCGCCACCACCCTCAAAGTCCGACGATCACCGGCGAGCGATATTCTCAACATCGAGACCTACACGT
CGGATAGCAACCTCGTGATCTCGAAGGCGCCAGGCGCCGAACGGCCGCTAATCGGCGCCGTCTACAGGAT
GAGTCCGCTCGCTGGAGGCGGTGGCGAATTCAGCACAGTCGTTCAAAACGTGTTCAAGGCCGTGCCCGAC
CAGTCGGTGATCCAGGTTACTCTGGTAATCCACCCTGACCACGACGCGCCGGATACCTATTTGAAGGGCA
AATTGTATGGCGGCCCTGTCGTGCAAGACCTGATCAAGCGGCAGGCGGACCTCTATCGCCGCGGACTCGC
GAGTGGCGAGCTACCTGATCTCCCTGGCATCAATAAGCGGACGGTCTACGTTTCGCTCGCAGTGCCGCAT
CGGAAAGCCGACGACGAGGCTGTCGAAAAATCCGCCAGCTTGCAACAAGAGTTCTTCACGAACATGCGCG
GGTGCGGCTTCCATGACGTCGTGCAGCTCAATATTAATCAACTGGTCGGCGTGTATAGGCAGATCACCAA
TATTTATGAGCCGGCCACCGTTCCGGAGCTCGACCCTACGCTCGATCTGCGGTATCAGGTATTTGGCCCG
GATCAGACTTTCGATTTCCGGGATCCCCACGTAGGCGAGATCAACGGGAACACGTACTGCACCACCGTCA
CGGTTAAAAAGTACCCCGAGCGTCCGTTCCACGGGATCATGAACCTGTTGAGCGGTGCACCGTTCAACTC
GGGCAGCGTGCGCGAGGGGGGAGGCCAGCGGATCGAGGGGCCGTGCATCATCACGACCACGGTGCGAGTC
GCGAATCAGCGCCGCGAATGGACGCGTGTCGAGAGCGCAATCCGCTCGCGTCGACAGCATCAGCCCCTTC
CCATCAAGCTCGGCGTCGAGGACACGCCACGCGTGCTCGCCGATCTCGAGGAGATTAAACGGCAATGCGC
AGAAGACGGCACGAAGTTCGTCTATGTTTCGACGAACGCGTTCCTCTTCGGCCGCGACCGCGACGAGGCG
GTCCGCGCTGGCGCATCCGTCAAAGGCACGCTGGACAAACTCGGTTTCGACGGGCGGGATGTGGTCGCTA
CCGGCTTGGTACGACTCGCCCAGACCCTACCCCTGAACTTTTCCAACACGATCGCCGACGACCTCGCTGG
CGAAGCGACGATGGCCAGCTCCGAGGTCGGGTGTTTGCTTCCCGTCTACGGCGACTATCTCGGAAACGTC
AACTCCGACTTTCCGCTGACGGGGATGGCCTACCCAACGCGTCGCGGGACGATGCACTACTTCGATCCGT
ATGTCAGCAACTCCAACTTCAACGGTGTTATGGCCGCTGAATCGGGTGTAGGCAAGTCGTTCAGTCTCCA
AGCCAAGATAACCGCGGAGCTCGCCGAGGGCGACAACATTGTTCTATTCGACAACGGCCGCAGCAGCCTG
AAGTTCTGCGCACTCATCGGGGGAGAATATAACGAATTCGGTGGCGCTAAAGCTTGGCGGCCATCGCTGC
AGCCGTTCTCCAACCTGACAGACGAGGAATTCGACGAGCAGCAAGAGACCATCACATCGCTCCACATGCT
GATGGCCTACGATGAGGAAAAGCCCGATCCCGGCGCAAGAATTGCATTAAGCGAAGCCGTCAAGGCTGCA
TGGGGGCAGCGCGGCAAGGATGCCGAAGTTTCGACGACGATCGCCTGTCTGCAGGCAATCGTCGAATCCG
CTGCAGAGAACCAGATTCAGAACCAAGTCCACGTCGCCGCGGCCAACCTCATCCCTCGGCTCAAGGCTTT
CGTTGACTCGCCGACCCGGGGCCCGTATTTCCGCGGTCCGAGCACACTCGACCCGAAAGCGCAGTTCACC
GTTTTCGAACTCGCCGGACTCGGCGACGACAACCACCTCAAGCGAGTCGTCCTGTTCTGCTGCGTCAACA
TCCTGCTTTCCCGCATCAAGAAGTTCAAGGGACGAAAGCGCATCTATGTCGACGAGGCCCAAGACCTTTT
TTCGATCGATTCGGCCGCTGACGCGTTCGAAGGCCTCTACCTCAAGGGGCGAAAAAACGGTGTCTCGGTC
TGGGTCATCGTCCAATCGCTCTTGAAGCTTGCCAGCTTCAAAGCGGGCTCGGTCATCCTCAGGCAGTCGG
CATGGAAGATGATCATGGCGCAGAAGAAGGACGAGATCGACGCCGTCATCGATCAGAAGGTAATGACCGC
GTTCGCGGACGACCCGTATTTTCAAAAGCTCATCAAGAGTGTCGAGTCGAAAAAGAACTTCTGGAGCGAA
ATTCTCATCATGAGCGACAAGACGTACGAGGTAGTACGTCTCTACGTCGATAAGTTTACGGCAACGCTAT
TCAGCTCGGAGGGAGCCGCGCGCGATGACGTGCTGCAGATGATGGAGGAGGGGGTAGGGCCTCTCGAGGC
CGTCCGGAAGGTGATGGGGGACAAGAAAGCGCGCCGGCGCGAATGGATGAGCGAATTTCTAGACATGTGC
AAAAACATCGACGGCCTGACCTTCAATGAGATCGTTAGAGAGCTCAAGGAGATCGCAAAATGA
 Primer design