SecReT4
Protein ID: 161506558
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6226
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]89914..90603 [-]
Producthypothetical protein
Component typeTraV_F
UniProt IDA9AU13
KEGG IDbmj:BMULJ_06195, bmu:Bmul_6226
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 2.2e-07, Aligned region: 25..155
Protein Sequence: 229 a.a.     [Download]
>gi|161506558|ref|YP_001573679.1| hypothetical protein Bmul_6226 [Burkholderia multivorans ATCC 17616]
MMILPAIAVSLAACSSAFNPIGSNTYDCNRKQDPTSIYCHSFRAVEASTNGRLPDSRFDTELKFSEYDKA
TDIAPPNRRDLTAPPLLTAGGQPVQLGSGGAASQPAPADATPLHAEMPVRMGPVIQRTWIKRFVDENDMW
TSDLTVLKEIAPSRWTGFDGGNPARAAGGVYPHKVADTPQDPSAGAVASAQSAPPAAAPPTTNDFIQPGG
PAPGGENPAGIPMPMSMPQ
 
Nucleotide Sequence: 690 bp     [Download]
>gi|161506495|ref|NC_010070.1|:c90603-89914 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
ATGATGATTTTGCCGGCCATCGCTGTTTCGCTCGCCGCTTGCTCGTCCGCATTCAATCCGATCGGGAGCA
ATACGTACGACTGCAATCGAAAGCAGGATCCGACGAGCATCTATTGCCATAGTTTCCGCGCGGTTGAAGC
TTCGACCAATGGTCGACTGCCTGATAGCCGCTTCGATACCGAGCTGAAATTTAGCGAGTACGACAAGGCA
ACTGACATCGCCCCGCCGAATCGTCGCGACTTGACCGCTCCCCCGCTACTGACTGCCGGCGGACAACCGG
TCCAGCTTGGCTCGGGTGGAGCGGCGTCCCAGCCTGCGCCGGCCGATGCGACGCCTCTGCACGCAGAGAT
GCCCGTCCGTATGGGTCCGGTAATCCAGCGGACCTGGATCAAGCGTTTCGTCGACGAGAACGACATGTGG
ACGAGCGACCTCACCGTGCTCAAGGAAATCGCGCCATCTCGATGGACAGGATTCGACGGTGGCAACCCCG
CACGGGCGGCCGGTGGCGTCTATCCGCACAAGGTTGCCGACACGCCTCAAGACCCGTCTGCTGGCGCGGT
CGCCTCGGCGCAAAGCGCGCCTCCGGCTGCTGCCCCGCCGACGACCAACGATTTCATCCAACCCGGCGGA
CCCGCGCCGGGCGGTGAAAACCCCGCTGGCATCCCGATGCCAATGTCAATGCCACAGTAA
 Primer design