SecReT4
Protein ID: 161506559
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6227
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]90627..91988 [-]
Producthypothetical protein
Component typeTraB_F
UniProt IDA9AU14
KEGG IDbmj:BMULJ_06194, bmu:Bmul_6227
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.8e-25, Aligned region: 233..442
Protein Sequence: 453 a.a.     [Download]
>gi|161506559|ref|YP_001573680.1| hypothetical protein Bmul_6227 [Burkholderia multivorans ATCC 17616]
MAMQFKWLEDRKQEWRDMEPKFRYLLVTVAVTGTAFILYQHFTRAPKADTAGAVAQGVVAPAAGLPPQPA
QPAPAPQGFAGTVGILPTSNRNQGLEDLAAQVGSLQQQVVTLTKAVSDGKAGGAPDASKLTTTWTPASAP
SASTPTPSDGSNNSPLGKDLPDAVNFDQPGNRPSSASGSIAGTAAADPAAFAAARPAEPPAPARPTLVVD
KPAPSTASAGNPKPDPTFPIYSGIEAVMLSGFNARQGGSNGGPAGAVTKAIDVGAPFVSRVKGATIMPNS
WKSSDLENCFIGGSATAVLSAERAYVISDKISCVFKNGEIYEGDIVAYGLDVDGNLGLAGKVVNKQGSML
MQAALTGMAAGLGSALAPTAVSSYNSNVSAGSTGAYTYPSPSFLLGTSVGTGVNKAATELSQFYLNFAKE
TFPVIEVTAGTRVTWILKQALTLKRKTPPKDQR
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|161506495|ref|NC_010070.1|:c91988-90627 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
ATGGCGATGCAATTTAAGTGGCTTGAAGATCGCAAGCAGGAATGGCGGGATATGGAGCCTAAGTTCCGCT
ACCTGCTGGTCACTGTCGCCGTCACGGGGACCGCCTTCATCCTGTACCAGCACTTCACACGAGCACCCAA
AGCGGACACCGCGGGCGCTGTTGCACAAGGAGTGGTCGCTCCCGCGGCCGGCTTGCCGCCTCAACCGGCG
CAGCCGGCGCCCGCGCCCCAAGGGTTTGCCGGCACCGTCGGCATTTTGCCGACGTCGAACCGGAACCAGG
GCCTCGAGGACTTGGCGGCACAGGTCGGCTCGCTCCAGCAGCAGGTTGTCACTCTGACAAAGGCGGTTTC
CGACGGCAAGGCTGGCGGCGCACCAGACGCATCGAAGCTGACGACGACATGGACGCCGGCAAGCGCGCCT
TCGGCATCGACGCCCACGCCGTCCGACGGTTCGAATAACAGTCCGCTGGGCAAGGATCTCCCTGACGCTG
TGAACTTTGATCAACCGGGAAATCGTCCGTCCAGCGCATCGGGCAGTATCGCAGGGACCGCGGCGGCCGA
CCCCGCGGCCTTCGCCGCCGCTCGACCGGCAGAGCCGCCGGCGCCGGCGCGCCCGACCTTAGTCGTGGAC
AAGCCAGCACCGTCGACTGCAAGTGCCGGAAACCCCAAACCGGACCCGACTTTCCCGATCTATTCGGGCA
TCGAGGCAGTCATGCTCTCCGGCTTCAACGCGCGCCAGGGCGGGTCGAACGGTGGTCCAGCCGGCGCCGT
CACGAAGGCGATCGACGTCGGCGCACCGTTCGTGTCCCGAGTGAAGGGGGCGACGATCATGCCGAACTCG
TGGAAGTCTTCCGACCTCGAGAACTGCTTCATCGGCGGCTCGGCTACTGCCGTCCTGTCCGCCGAGCGCG
CGTACGTTATCTCCGACAAGATCAGCTGCGTCTTCAAGAACGGGGAAATCTATGAAGGTGACATTGTCGC
GTACGGACTGGACGTCGACGGCAACCTAGGTCTCGCCGGAAAGGTCGTGAATAAGCAGGGCTCCATGCTG
ATGCAAGCCGCGCTGACGGGCATGGCCGCCGGCCTCGGGTCGGCACTCGCTCCGACGGCTGTCTCTAGCT
ACAACAGCAACGTGAGCGCCGGCTCGACTGGCGCCTATACCTACCCGAGTCCCAGCTTTCTGCTCGGCAC
CTCGGTTGGTACCGGTGTGAATAAGGCCGCAACGGAGCTCTCGCAGTTTTACCTGAACTTCGCCAAGGAA
ACGTTCCCGGTCATCGAAGTAACCGCGGGTACTCGAGTCACCTGGATTCTCAAGCAAGCGCTCACCCTGA
AGCGCAAGACGCCCCCCAAGGACCAACGATGA
 Primer design