SecReT4
Protein ID: 161506560
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6228
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]91988..92980 [-]
Producthypothetical protein
Component typeTraK_F
UniProt IDA9AU15
KEGG IDbmu:Bmul_6228
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 3.2e-27, Aligned region: 117..322
Protein Sequence: 330 a.a.     [Download]
>gi|161506560|ref|YP_001573681.1| hypothetical protein Bmul_6228 [Burkholderia multivorans ATCC 17616]
MDQSSTEEVKPMKTRYLSALMAVYFGSTLSTVAFAQGASASVDFGVATPPAIESAATTTTTTKTKPKLHG
HVKRTRDPLKVDASIAVKNTPQKEIVLPGVLTVPGEGIGVPDPSNVQKVSWTNTGNKTVYLSADEPNRIL
LPFKNAYIVHTSDVQVDKREQSNNVYVYWTNAPSQARHLYIEPPDGGSALGLAIVPKKIPAQTILVTDDT
GIVSGRRPKSSPGSEYTSHIQDLMAAIALGKAPDGFSQVDIQLPPIAMNGLSATVDTRYSSQEGDLYVYT
VRNPTQSRAVLREEEFDGPEVIAVSIYPKPVLLPGEKTRVIVMARKREEQ
 
Nucleotide Sequence: 993 bp     [Download]
>gi|161506495|ref|NC_010070.1|:c92980-91988 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
ATGGATCAAAGCTCAACAGAAGAAGTGAAGCCGATGAAAACCCGCTACCTTTCCGCCCTTATGGCGGTCT
ATTTCGGATCGACACTGTCCACTGTTGCGTTTGCCCAAGGCGCATCAGCGTCCGTGGACTTTGGCGTTGC
TACGCCGCCGGCTATTGAATCCGCGGCGACGACGACGACGACGACGAAGACGAAGCCGAAGCTCCATGGC
CACGTGAAACGGACCCGTGATCCCCTGAAGGTTGATGCGTCAATCGCAGTTAAGAACACACCGCAGAAGG
AAATCGTTCTTCCTGGCGTTTTGACGGTACCCGGCGAGGGCATTGGCGTGCCCGACCCGTCCAATGTCCA
GAAGGTCTCCTGGACCAACACAGGCAACAAAACGGTATACCTGAGCGCAGACGAGCCGAACCGGATTCTG
CTGCCGTTCAAGAATGCGTACATTGTCCACACGAGTGACGTTCAAGTCGACAAGCGTGAGCAAAGCAATA
ACGTGTACGTCTACTGGACGAACGCTCCTTCGCAAGCTCGCCACCTGTATATCGAGCCGCCCGACGGGGG
GTCAGCGCTCGGTCTCGCTATCGTCCCGAAGAAGATCCCCGCGCAAACAATTCTCGTGACCGACGATACC
GGCATTGTATCGGGGCGACGCCCCAAGTCGTCGCCAGGCAGTGAGTACACATCCCATATTCAGGACTTGA
TGGCGGCGATCGCTTTGGGAAAGGCGCCGGATGGCTTCTCACAGGTTGACATCCAGTTGCCTCCCATAGC
AATGAACGGCCTCTCCGCCACCGTTGACACCCGGTACAGCAGCCAAGAGGGCGATCTCTACGTCTATACG
GTTCGAAATCCAACGCAGAGCAGGGCCGTGTTGCGCGAGGAGGAATTCGACGGCCCTGAGGTCATCGCGG
TATCGATTTACCCGAAACCGGTACTTCTTCCTGGAGAGAAGACCCGCGTGATCGTGATGGCGCGTAAGCG
CGAGGAGCAGTAA
 Primer design