SecReT4
Protein ID: 161506561
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6229
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]92953..93552 [-]
Producthypothetical protein
Component typeTraE_F
UniProt IDA9AU16
KEGG IDbmj:BMULJ_06192, bmu:Bmul_6229
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 199 a.a.     [Download]
>gi|161506561|ref|YP_001573682.1| hypothetical protein Bmul_6229 [Burkholderia multivorans ATCC 17616]
MNRTARDKSIAEYKQLNRYLSIGIGCLGIAVLLLSLRVIFQNVIVQMQVPGMPDGAKIERNGMDVGAMQA
YAFAVTNALASVNPSNGESTKRFVQPFLSPAAYTKVSLAIDQKIETLKSQRELGSYYFVLKRFDADEKLG
RVFVQGDVHTVNAAKDTGEPWVFEYPVRFGNYRMTMDDVIAYPGDKAHTSEWIKAQQKK
 
Nucleotide Sequence: 600 bp     [Download]
>gi|161506495|ref|NC_010070.1|:c93552-92953 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
ATGAATCGCACAGCAAGAGATAAATCGATCGCCGAATACAAGCAGCTGAACCGATATCTCTCGATCGGGA
TCGGCTGCTTGGGCATTGCAGTCCTGCTGCTGTCTTTGCGGGTGATCTTCCAGAACGTCATCGTCCAAAT
GCAGGTTCCGGGAATGCCAGATGGCGCGAAGATCGAGCGCAACGGGATGGATGTCGGTGCAATGCAAGCG
TATGCGTTCGCAGTGACTAATGCTCTCGCATCGGTCAATCCGAGTAACGGCGAATCCACGAAACGCTTCG
TTCAGCCATTTCTCTCACCTGCGGCGTACACGAAAGTCAGTTTGGCAATCGACCAGAAGATCGAGACGCT
GAAGTCGCAGCGCGAGCTGGGAAGCTATTACTTTGTTCTGAAGCGCTTCGATGCCGACGAGAAACTTGGG
CGCGTGTTCGTCCAAGGTGACGTCCATACCGTCAACGCAGCCAAGGATACCGGGGAGCCATGGGTCTTCG
AATACCCGGTCCGCTTTGGCAATTATCGAATGACGATGGACGACGTCATCGCCTACCCCGGCGACAAGGC
TCATACCTCCGAATGGATCAAAGCTCAACAGAAGAAGTGA
 Primer design