SecReT4
Protein ID: 161506563
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6231
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]94437..94934 [-]
Producthypothetical protein
Component typeTrbC_F
UniProt IDA9AU18
KEGG IDbmj:BMULJ_06191, bmu:Bmul_6231
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 7.9e-19, Aligned region: 33..138
Protein Sequence: 165 a.a.     [Download]
>gi|161506563|ref|YP_001573684.1| hypothetical protein Bmul_6231 [Burkholderia multivorans ATCC 17616]
MNRLIVALALFAAAPVHGEPSLSETIAAPWNTYIFVSSRMPLQSIIQVTREASRAHAVIVLTGFAGEEPT
LTSTQRYAADINRACCTTQPARWIVDPVLTRRYGVTAAPSFVIAHGASENPGEFSKVAGDMSLSQALKFF
AQNSRLPSARDYASKLYYATYGTKY
 
Nucleotide Sequence: 498 bp     [Download]
>gi|161506495|ref|NC_010070.1|:c94934-94437 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
ATGAATCGCTTGATCGTCGCGCTTGCACTCTTCGCCGCAGCACCAGTCCACGGCGAACCCTCGCTCAGTG
AAACGATCGCTGCGCCGTGGAACACATATATCTTCGTTTCGAGCCGAATGCCGCTTCAATCGATCATCCA
GGTCACGCGCGAAGCGAGTCGAGCTCACGCCGTCATAGTGCTCACGGGTTTTGCAGGTGAGGAGCCGACA
CTTACCAGCACGCAGCGATACGCAGCTGACATTAATCGGGCTTGCTGCACGACGCAGCCCGCGCGCTGGA
TCGTCGATCCCGTGCTCACGCGTCGGTACGGCGTAACCGCGGCCCCGTCATTCGTAATTGCACACGGAGC
GAGCGAAAACCCCGGCGAATTCTCCAAAGTCGCTGGCGACATGAGCCTTTCGCAGGCGCTCAAGTTTTTC
GCGCAGAACTCGAGATTGCCTTCCGCGCGCGACTATGCGTCGAAGTTGTACTACGCGACCTACGGCACGA
AATATTAA
 Primer design