SecReT4
Protein ID: 161506564
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6232
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]94946..95959 [-]
ProductTraU family protein
Component typeTraU_F
UniProt IDA9AU19
KEGG IDbmj:BMULJ_06190, bmu:Bmul_6232
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 7.1e-62, Aligned region: 26..332
Protein Sequence: 337 a.a.     [Download]
>gi|161506564|ref|YP_001573685.1| TraU family protein [Burkholderia multivorans ATCC 17616]
MRLWASVVLALCLSGNANAQALCNGSFPNLITDVCYDCIFPISIMGGFINMGVSGDDYDTGASHFPVCVC
ANNLAVGTPVSFWEPRYMVDTTTKPGCMPLLGGIDIKTPYNAAEYGAENVTNAAISGKRKAAFMQVNEYV
NPIMSALGVVVNNPCLDNRSFDVPFLSWADPTWNDDALSLMLTPYAYPFAGIPSIAAELPDAISATFGFP
MEILFWVAGAWGPMYPLNGNVAIANTPEQVSHLMIARLFAKLHAAGAAQATAGNDALQSCGALGVPQLVM
DKRQYKTNRVFPFPDNKCTPIGRPLAFQEIGAARPQDKDYGYIIFQRKDCCATKTIQ
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|161506495|ref|NC_010070.1|:c95959-94946 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
ATGCGTCTTTGGGCTTCGGTCGTCTTGGCACTTTGCCTCTCTGGTAACGCAAACGCCCAAGCACTTTGCA
ATGGCAGCTTCCCGAACCTTATCACGGACGTCTGCTACGACTGCATTTTCCCGATCTCGATTATGGGCGG
GTTCATCAACATGGGCGTGTCAGGCGACGACTACGACACGGGCGCAAGCCACTTTCCAGTTTGCGTCTGC
GCAAACAACTTGGCAGTGGGCACCCCAGTCTCGTTCTGGGAGCCACGGTATATGGTCGACACCACGACCA
AACCCGGTTGCATGCCGTTGCTCGGTGGCATAGATATCAAGACCCCGTACAACGCAGCTGAGTATGGCGC
GGAGAACGTTACCAACGCGGCAATCAGCGGGAAGCGAAAAGCGGCCTTCATGCAGGTGAATGAATACGTG
AACCCGATCATGTCAGCACTCGGCGTGGTCGTGAACAATCCGTGCCTGGACAACCGTTCGTTCGACGTCC
CTTTCCTCAGCTGGGCCGACCCGACATGGAACGACGATGCACTTTCGCTGATGCTTACCCCATACGCATA
TCCCTTTGCCGGGATTCCGAGCATCGCGGCCGAGTTGCCGGACGCAATCTCCGCGACGTTCGGGTTCCCG
ATGGAGATTCTTTTCTGGGTGGCCGGAGCGTGGGGGCCGATGTACCCACTGAACGGCAATGTCGCGATCG
CCAACACCCCGGAGCAGGTATCGCACCTGATGATCGCGCGCCTCTTTGCCAAGCTCCACGCTGCCGGAGC
TGCGCAAGCCACCGCGGGAAACGACGCCCTTCAATCGTGTGGCGCGCTGGGGGTCCCTCAGCTCGTGATG
GACAAGCGTCAGTACAAGACGAACCGTGTCTTTCCGTTTCCCGACAACAAATGCACGCCGATCGGGCGGC
CGCTCGCTTTCCAAGAGATAGGCGCCGCACGCCCGCAAGACAAGGATTACGGATACATCATCTTCCAGCG
CAAAGACTGCTGCGCGACGAAGACCATTCAGTAA
 Primer design