SecReT4
Protein ID: 161506565
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6233
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]95968..96636 [-]
Productsex pilus assembly and synthesis protein
Component typeTraW_F
UniProt IDA9AU20
KEGG IDbmj:BMULJ_06189, bmu:Bmul_6233
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 222 a.a.     [Download]
>gi|161506565|ref|YP_001573686.1| sex pilus assembly and synthesis protein [Burkholderia multivorans ATCC 17616]
MNRIPKLLIGLAASLQLSISYAEDLGTKAQTYPLDRDAAEQIKDIFRRKQQSGELDAFWKNYRDRTIESI
KNPPSLGIATSYGVRTELRELRFQIPQDYRDHTGKVIVRRGTVVEPLKVMPLTNGLLFIDGTDARQVEYA
IRRSQSERLKIVLTAGSPYALRVKYAKVPWHGGTGVPFYFDQRRMIISTLSKLYNIQINSVPAAIFQQGD
RLAVQFGMEGAN
 
Nucleotide Sequence: 669 bp     [Download]
>gi|161506495|ref|NC_010070.1|:c96636-95968 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
ATGAACCGCATCCCGAAATTGCTCATCGGGCTCGCAGCCTCGCTGCAACTCTCCATTTCCTATGCCGAGG
ACCTCGGCACAAAGGCACAAACCTATCCGCTTGATCGCGACGCGGCTGAGCAGATCAAGGACATTTTCCG
GAGAAAGCAGCAATCAGGCGAACTCGATGCATTCTGGAAGAACTATCGCGATCGCACGATTGAGAGCATC
AAGAACCCGCCGTCCCTCGGTATAGCCACAAGCTACGGCGTGCGCACCGAGCTGCGCGAACTGCGTTTCC
AGATTCCGCAAGACTATCGCGATCACACCGGGAAGGTCATCGTTCGGCGCGGGACTGTCGTAGAGCCCCT
CAAGGTCATGCCGCTGACGAACGGACTTCTGTTCATCGATGGGACCGACGCTCGTCAGGTCGAGTATGCG
ATCAGGCGCAGTCAGTCCGAGCGCTTAAAGATCGTATTGACCGCGGGCTCTCCGTATGCGCTTCGCGTGA
AGTACGCGAAAGTGCCGTGGCATGGGGGGACGGGTGTTCCCTTTTACTTCGATCAACGCCGAATGATCAT
CAGCACGCTGTCCAAGCTGTACAACATCCAGATCAACAGTGTGCCGGCGGCAATTTTCCAACAAGGCGAC
AGGCTCGCCGTCCAGTTTGGTATGGAGGGCGCAAATTGA
 Primer design