SecReT4
Protein ID: 161506566
T4SS name [ID]Tra_F [804]
Gene symbol-
Locus tagBmul_6234
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pBMUL01 [GenBank: NC_010070] [Browse all T4SS(s) in this replicon]
Location [Strand]96636..97091 [-]
Productlytic transglycosylase catalytic
Component typeOrf169_F
UniProt IDA9AU21
KEGG IDbmu:Bmul_6234
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 151 a.a.     [Download]
>gi|161506566|ref|YP_001573687.1| lytic transglycosylase catalytic [Burkholderia multivorans ATCC 17616]
MNACFENAARKRHISVDLLRAIGHVESRFRPWVTNAQSGAIGVMQIMPVHLKWLRKYGIEREDLYDGCTN
INVGAFVLADMIRMFGPTWRAVGAYGAGIAANKEQARKEYATLVQASLEQLKRSGSPALPPVRAQLITTP
AAPSRPKMVVD
 
Nucleotide Sequence: 456 bp     [Download]
>gi|161506495|ref|NC_010070.1|:c97091-96636 Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence
TTGAATGCGTGCTTCGAAAATGCTGCCCGCAAGCGGCACATCAGCGTCGACCTGCTCCGAGCGATCGGTC
ATGTCGAATCCCGATTCCGACCTTGGGTGACCAACGCTCAATCCGGCGCAATCGGCGTGATGCAGATCAT
GCCGGTCCATCTCAAATGGCTCAGAAAATACGGTATCGAGCGAGAGGACCTGTACGACGGATGCACAAAT
ATCAACGTCGGCGCCTTCGTCCTCGCCGACATGATCCGGATGTTCGGCCCGACGTGGCGTGCCGTTGGTG
CCTATGGCGCTGGAATTGCGGCGAATAAGGAACAGGCACGCAAGGAGTACGCCACCCTTGTTCAAGCGTC
GCTCGAACAGCTCAAGCGTAGCGGCTCGCCCGCCCTTCCTCCTGTCAGGGCGCAGCTGATCACGACGCCC
GCGGCTCCCTCTCGACCAAAGATGGTGGTGGACTAA
 Primer design