SecReT4
Protein ID: 161522579
T4SS name [ID]Trb [799]
Gene symbol-
Locus tagBmul_5546
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome 3 [GenBank: NC_010087] [Browse all T4SS(s) in this replicon]
Location [Strand]260975..261850 [+]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDA9ARP4
KEGG IDbmj:BMULJ_05953, bmu:Bmul_5546
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.6e-47, Aligned region: 66..283
Protein Sequence: 291 a.a.     [Download]
>gi|161522579|ref|YP_001585508.1| conjugal transfer protein TrbG/VirB9/CagX [Burkholderia multivorans ATCC 17616]
MKRTRSLLGWGALAVIAASANAFAAKSAANPIAPVPNFDVGSIIGDAMSPVNPYNSGADPITMPGDARMA
VFTYSRDKIFRVMTAPLKLTTIELERGETLVSEPAMGDSVQWVLDTDGANHVYVKPTKPGLVNTLHLSTN
RREYELTLVSSPLGGLFYQNVRFSYANSLMAKVRARGNATGEEHDTDQGAPSDSGPIGVSPDKLNFEYTV
SGTNSLKPETVFDDGTFIWIRMPPRTPFAVPTIKDGGDVVSPNFIRRGPYIVIQRLADEVKLTRPGEEVT
ITRGRRGLFGF
 
Nucleotide Sequence: 876 bp     [Download]
>gi|161522356|ref|NC_010087.1|:260975-261850 Burkholderia multivorans ATCC 17616 chromosome 3, complete sequence
ATGAAACGAACACGTTCCCTCCTGGGCTGGGGCGCGCTGGCGGTGATCGCGGCATCGGCCAATGCGTTCG
CAGCCAAATCTGCAGCGAACCCGATTGCCCCCGTCCCGAATTTCGATGTCGGCAGCATCATCGGCGATGC
GATGAGCCCGGTGAATCCCTACAACTCTGGCGCGGATCCGATCACGATGCCGGGCGATGCACGCATGGCA
GTGTTCACGTATAGCCGCGACAAGATCTTTCGGGTGATGACTGCGCCGCTGAAGCTCACGACAATTGAGC
TCGAGCGCGGCGAGACCTTGGTCAGCGAGCCAGCGATGGGCGACTCCGTGCAGTGGGTTCTCGATACGGA
CGGCGCAAATCACGTCTACGTGAAGCCCACTAAGCCGGGCCTCGTCAACACGCTGCACCTGAGCACAAAC
CGGCGCGAGTACGAGCTGACGCTCGTTTCCTCCCCGTTGGGTGGCCTGTTTTATCAGAACGTGCGCTTCA
GCTACGCGAACTCGCTGATGGCGAAGGTGCGGGCACGCGGCAACGCAACGGGGGAAGAACACGATACTGA
CCAAGGCGCCCCATCCGATTCCGGTCCTATCGGCGTATCGCCTGACAAGCTGAACTTCGAGTACACCGTC
TCGGGGACGAACTCACTCAAACCCGAGACGGTCTTCGACGACGGCACGTTCATCTGGATCCGGATGCCGC
CTCGCACGCCGTTTGCCGTGCCCACCATCAAGGATGGCGGTGACGTCGTCAGCCCGAACTTTATCCGCCG
CGGTCCATACATTGTCATTCAGCGACTGGCCGATGAGGTCAAGCTCACGCGACCCGGCGAGGAAGTGACG
ATCACGCGCGGCCGGCGCGGCCTGTTCGGGTTCTGA
 Primer design