SecReT4
Protein ID: 161522640
T4SS name [ID]Trb [799]
Gene symbol-
Locus tagBmul_5607
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome 3 [GenBank: NC_010087] [Browse all T4SS(s) in this replicon]
Location [Strand]315894..316274 [+]
Producthypothetical protein
Component typeTrbC
UniProt IDA9ARV5
KEGG IDbmj:BMULJ_05897, bmu:Bmul_5607
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.1e-05, Aligned region: 31..115
Protein Sequence: 126 a.a.     [Download]
>gi|161522640|ref|YP_001585569.1| hypothetical protein Bmul_5607 [Burkholderia multivorans ATCC 17616]
MKKHLQSLRSLVRKKVRHTAHYYFGRGHRLSTLIALALTFAAPAAKAVDLSDLGSATAIICLIQAYVSGP
WLMAIGVVLIIVGAVAIANSESNIGKFLSSVIVGIGLAACAIPIVKNQLKINYTCA
 
Nucleotide Sequence: 381 bp     [Download]
>gi|161522356|ref|NC_010087.1|:315894-316274 Burkholderia multivorans ATCC 17616 chromosome 3, complete sequence
ATGAAGAAGCACCTCCAATCGTTGCGTTCGCTGGTCCGGAAAAAGGTCCGGCACACCGCGCACTACTACT
TCGGGCGTGGCCACCGGCTCTCCACGCTGATCGCGCTGGCGCTGACGTTCGCAGCACCGGCCGCGAAAGC
CGTCGACCTCAGCGACCTGGGTAGCGCGACCGCCATCATTTGTCTGATCCAGGCCTACGTCAGCGGCCCG
TGGCTCATGGCGATTGGCGTGGTGCTGATCATTGTCGGTGCGGTCGCGATCGCGAATTCGGAAAGCAATA
TCGGGAAATTCCTTTCCTCCGTGATCGTCGGGATCGGTCTCGCCGCGTGCGCGATTCCAATCGTCAAAAA
CCAGTTGAAGATCAACTACACCTGTGCGTGA
 Primer design