SecReT4
Protein ID: 161522644
T4SS name [ID]Trb [799]
Gene symbol-
Locus tagBmul_5611
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome 3 [GenBank: NC_010087] [Browse all T4SS(s) in this replicon]
Location [Strand]320022..321032 [+]
Producthypothetical protein
Component typeTrbL
UniProt IDA9ARV9
KEGG IDbmu:Bmul_5611
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.8e-17, Aligned region: 97..311
Protein Sequence: 336 a.a.     [Download]
>gi|161522644|ref|YP_001585573.1| hypothetical protein Bmul_5611 [Burkholderia multivorans ATCC 17616]
MRNSAFRVLLRGGLILLALALPIVARAALLDGLSEAMSSGWSSSYVNGEVAKGASAAIDTIGQIMKDLID
LAVELSRTLDKESNKMAFGLSVTTVVLASLRFGATKDPIAAWQSLFEDLAILGIFAAIYIAYDRWAPGFY
KWFNEMAIAISGTDADSLPMAMVKSAGAIYDSVIEALKAEHWWNYIALLINLAPLLFAWLFLMLAALVFL
FYVSLGTIQMAVAIVMGKIAFALGMSEFTRGWFKSWLDYTISAGMYMVVAAILQRLMTTTIAKSFGDTIS
KGLTTPYAGSLTLDMSIFVLILAFEIPKFASMFGGGASASGSAFKSLTKMATKGLA
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|161522356|ref|NC_010087.1|:320022-321032 Burkholderia multivorans ATCC 17616 chromosome 3, complete sequence
ATGAGGAATAGCGCGTTCCGCGTGTTGCTCCGTGGCGGGCTAATCTTGCTCGCGCTTGCGCTTCCGATCG
TGGCCCGTGCGGCGCTACTCGACGGCTTGTCGGAGGCGATGTCATCTGGCTGGAGCTCGAGCTACGTGAA
CGGTGAGGTCGCGAAGGGTGCCAGCGCCGCGATCGATACGATCGGGCAGATCATGAAGGATCTGATCGAT
CTCGCTGTCGAACTCTCCAGGACGCTCGACAAGGAATCCAACAAGATGGCGTTCGGGCTATCGGTCACGA
CGGTCGTGCTGGCGTCGCTTAGGTTCGGTGCGACCAAGGATCCAATCGCCGCCTGGCAGAGTTTGTTCGA
AGACCTCGCGATACTGGGCATCTTTGCGGCGATCTACATTGCGTACGACAGATGGGCGCCCGGGTTCTAC
AAGTGGTTTAACGAGATGGCGATCGCGATTTCAGGAACCGACGCGGATTCGTTGCCGATGGCGATGGTGA
AGTCGGCCGGCGCGATCTATGACTCGGTCATCGAAGCACTGAAGGCAGAGCATTGGTGGAACTACATCGC
GCTGTTGATCAACCTTGCACCGCTGCTATTCGCATGGTTGTTCCTGATGCTGGCGGCCCTCGTGTTTCTC
TTCTATGTCTCGTTGGGCACGATTCAAATGGCCGTCGCGATCGTGATGGGCAAGATTGCATTCGCACTCG
GCATGTCGGAGTTCACGCGAGGATGGTTCAAGAGCTGGCTCGATTACACGATCAGCGCAGGCATGTATAT
GGTCGTCGCCGCAATTCTTCAGCGTCTGATGACCACAACCATCGCGAAGTCGTTCGGGGACACGATATCG
AAGGGACTGACGACGCCGTATGCCGGGTCGCTCACGCTGGACATGTCAATCTTCGTGCTGATCCTCGCAT
TTGAAATTCCGAAGTTTGCGTCGATGTTCGGGGGTGGGGCAAGCGCGAGCGGCTCGGCGTTCAAGAGCCT
GACGAAGATGGCGACCAAGGGGTTGGCGTAA
 Primer design