SecReT4
Protein ID: 161525521
T4SS name [ID]Trb [322]
Gene symbol-
Locus tagBmul_2351
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome 1 [GenBank: NC_010084] [Browse all T4SS(s) in this replicon]
Location [Strand]2560768..2561145 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA9AEC9
KEGG IDbmj:BMULJ_00890, bmu:Bmul_2351
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.4e-23, Aligned region: 26..115
Protein Sequence: 125 a.a.     [Download]
>gi|161525521|ref|YP_001580533.1| conjugal transfer protein TrbC [Burkholderia multivorans ATCC 17616]
MTHVDAFRLSVNPHPSLARLRLLARPAAQGLLLAALMLLLAGTAQAAGSSMPWEGPLTSILESIQGPVAR
IVAVIIIISTGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 378 bp     [Download]
>gi|161523180|ref|NC_010084.1|:2560768-2561145 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGACGCACGTTGATGCTTTCCGTCTTTCCGTAAATCCGCATCCCAGTCTCGCAAGACTGCGCCTCCTGG
CTCGCCCTGCCGCACAGGGACTGCTGCTGGCCGCACTGATGTTGCTGCTGGCCGGCACGGCGCAGGCCGC
CGGTTCCAGCATGCCGTGGGAAGGTCCGCTGACCTCCATCCTCGAATCGATCCAGGGGCCAGTGGCCCGG
ATCGTGGCGGTGATCATCATCATTTCCACCGGACTGGCGTTGGCGTTCGGCGACACCAGCGGGGGCTTTC
GCAAGCTGATCCAGATCGTGTTCGGCCTGTCCATCGCGTTCGCCGCGTCCTCGTTCTTCCTGTCGTTCTT
CAGCTTCTCCGGCGGGGCCGTCGTATGA
 Primer design