SecReT4
Protein ID: 161525526
T4SS name [ID]Trb [322]
Gene symbol-
Locus tagBmul_2356
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome 1 [GenBank: NC_010084] [Browse all T4SS(s) in this replicon]
Location [Strand]2564924..2566306 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA9AED4
KEGG IDbmj:BMULJ_00885, bmu:Bmul_2356
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 8.9e-50, Aligned region: 37..264
Protein Sequence: 460 a.a.     [Download]
>gi|161525526|ref|YP_001580538.1| conjugal transfer protein TrbL [Burkholderia multivorans ATCC 17616]
MNDVTIIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTIAGLYWAMSQATGQGEDVIAKLLRKVLY
VGAFAYIIGNFNWLASIVFRSFAGLGLTATGSTMTMENFLQPGRLAKTGIDAGAPILEQIGNMAGFPEVF
VNIDPIVVMFLAWLTVILCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVSSGIK
VLVLAVIVGIGSGLFAEFQVHPDEPSIDHALVVMLASLALLALGIYGPGIATGLVSGAPQLGAGAMAGAA
VGAAGTAVAIGAAATGVGGAVMAGARMAPAAAKLAGAGARAATSVAGGAKSAFQEGSAAAGGGAKGAKAG
LGNVAKTGAQSAGRSAASGASGAAQKMTGSFRAGLNGTEAGGDAASGAAGAGQAAADGTASSQKQAQPAW
AKRMHRRQQITHAATTAAHTLRGGDGGGSGQGPSLRGSDD
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|161523180|ref|NC_010084.1|:2564924-2566306 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAACGACGTGACCATCATCGACCGTTTCCTCGATACGTTCTCCCGCTACATCGACTCCGGGTTCGGCC
TGCTGCAAGGCGAAGTGGCGTTCCTGACGGCTACGCTGATCGTCATCGACATGACCATCGCGGGCCTGTA
TTGGGCCATGAGCCAGGCCACTGGCCAGGGCGAGGACGTGATCGCCAAGCTGCTGCGTAAGGTGCTCTAC
GTCGGTGCCTTCGCCTACATCATCGGCAACTTCAACTGGCTGGCCAGCATCGTCTTCCGCTCGTTTGCTG
GACTGGGCCTGACGGCCACCGGCTCGACCATGACGATGGAGAACTTTCTGCAACCAGGGCGGCTAGCCAA
GACCGGTATCGACGCCGGCGCGCCGATTCTGGAGCAGATCGGCAACATGGCGGGCTTCCCCGAAGTCTTC
GTGAATATCGACCCCATCGTGGTGATGTTCCTCGCCTGGCTCACCGTGATCCTGTGTTTCTTCGTGCTGG
CGATCCAGCTTTTCATCACGCTGATCGAGTTCAAGCTGACCACGCTCGCGGGCTTCGTGCTGGTGCCGTT
CGCGCTGTGGAACAAGACCTCGTTTCTCGCCGAAAAGGTACTCGGCAACGTGGTGTCGTCGGGCATCAAG
GTCTTGGTGCTGGCTGTCATCGTCGGCATCGGTTCGGGCCTGTTCGCGGAGTTCCAGGTTCACCCCGACG
AACCCTCCATCGATCACGCCCTTGTCGTGATGCTGGCCTCGCTCGCGCTGCTGGCGCTGGGCATCTATGG
GCCGGGCATCGCAACCGGCCTGGTGTCTGGTGCGCCGCAGCTTGGCGCCGGCGCGATGGCGGGTGCCGCT
GTCGGTGCCGCCGGCACAGCCGTTGCCATCGGTGCCGCCGCGACCGGCGTGGGCGGTGCGGTCATGGCCG
GGGCACGCATGGCGCCGGCGGCCGCGAAGCTGGCCGGCGCCGGTGCGCGTGCCGCCACGTCGGTCGCCGG
CGGCGCAAAATCGGCATTCCAAGAGGGTTCCGCCGCTGCGGGCGGCGGCGCCAAGGGTGCGAAGGCCGGC
TTGGGCAATGTCGCCAAGACCGGCGCGCAGTCTGCCGGGCGCAGCGCCGCATCTGGCGCGTCCGGCGCAG
CGCAGAAGATGACCGGCTCTTTCCGCGCTGGATTGAACGGTACAGAGGCCGGTGGCGACGCTGCGTCCGG
TGCGGCTGGCGCCGGCCAGGCAGCCGCAGACGGCACCGCCAGCTCGCAGAAGCAAGCGCAGCCCGCATGG
GCCAAGCGGATGCACCGCCGCCAGCAGATCACCCATGCCGCGACCACTGCCGCACACACGTTGCGCGGCG
GCGATGGCGGCGGCTCCGGGCAAGGCCCGAGCCTGCGCGGCTCCGACGACTGA
 Primer design