SecReT4
Protein ID: 161525528
T4SS name [ID]Trb [322]
Gene symbol-
Locus tagBmul_2358
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome 1 [GenBank: NC_010084] [Browse all T4SS(s) in this replicon]
Location [Strand]2567032..2568033 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA9AED6
KEGG IDbmj:BMULJ_00883, bmu:Bmul_2358
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.7e-68, Aligned region: 103..322
Protein Sequence: 333 a.a.     [Download]
>gi|161525528|ref|YP_001580540.1| P-type conjugative transfer protein TrbG [Burkholderia multivorans ATCC 17616]
MNLPFRFYAFVLMFAALSGCASQGKPPPTISLDEPVQAQPLPEPPKPVEVVAVPEPLALPAQLKPLPKLD
EAATAPEPADEKMRVSRANAEARIAPTREGYVNAIQVWPYSDGALYQVYAAPGRVTVVSLQPGEELVTVA
AGDTVRWIVGDTSSGSGEALRVNVLVKPTRSGLKTNLVITTSRRTYLLELTSTEKAWMASVSWDYPKDRM
LALQRQAQAAQTAAPVDTGLALEKIRFRYTISGSNPPWKPQRAFDDGEKVYIQFPPGIAQGELPPLFVIG
AQGDGQLVNYRFRSPYYIVDRLFGAAELRLGGDGGDVVRIERTDGAVGAARRN
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|161523180|ref|NC_010084.1|:2567032-2568033 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAACCTGCCTTTCCGCTTTTACGCTTTCGTGCTGATGTTCGCAGCTCTGTCGGGTTGCGCCTCGCAAG
GCAAGCCACCGCCGACCATCTCGCTCGATGAGCCAGTGCAGGCGCAGCCGCTGCCCGAACCGCCCAAGCC
GGTCGAAGTCGTCGCCGTGCCCGAGCCACTGGCGCTGCCGGCGCAGTTGAAGCCGCTGCCGAAGCTGGAC
GAGGCAGCGACCGCGCCGGAGCCGGCCGACGAGAAGATGCGCGTCTCGCGCGCCAATGCCGAGGCGCGCA
TCGCGCCGACCCGCGAGGGCTACGTCAACGCGATTCAGGTGTGGCCGTATAGCGACGGCGCGTTGTATCA
GGTCTATGCGGCACCGGGGCGCGTCACCGTGGTTTCGCTCCAGCCTGGCGAGGAACTGGTGACGGTCGCC
GCTGGCGATACCGTGCGCTGGATCGTCGGCGACACGTCCAGCGGCAGCGGCGAGGCGTTGCGCGTCAATG
TGCTAGTCAAGCCCACCCGTTCGGGCCTGAAAACCAATCTGGTCATCACCACCAGCCGGCGGACGTACCT
GCTGGAACTGACTTCGACCGAGAAGGCATGGATGGCCTCGGTGTCATGGGACTACCCGAAAGACCGGATG
CTGGCCTTGCAGCGCCAGGCGCAGGCTGCACAGACAGCCGCGCCGGTCGATACCGGCCTGGCGTTGGAGA
AGATCCGCTTCCGCTACACGATCAGCGGCAGCAATCCGCCGTGGAAGCCGCAGCGGGCCTTCGATGATGG
CGAGAAGGTCTACATCCAGTTCCCGCCGGGCATCGCGCAAGGCGAACTGCCGCCGCTGTTCGTCATCGGC
GCGCAGGGTGACGGGCAACTGGTCAATTACCGTTTCCGTTCGCCGTACTACATCGTGGATCGACTCTTTG
GTGCGGCCGAACTGCGCCTGGGTGGCGATGGTGGTGACGTGGTGCGGATCGAGCGCACCGACGGGGCTGT
GGGCGCAGCGCGGAGGAACTGA
 Primer design